Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.63
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Idiopathic scoliosis 31 3.676 1.8
Syndactyly 88 3.504 1.8

Expression

Gene RIF (1)

AA Sequence

MASFKLADSVWEDSLSKRQRNQGRMKTLPVLVLSLTLLTVFSETSPILTEKQAKQLLRSRRQDRPSKPGF      1 - 70
PDEPMREYMHHLLALEHRAEEQFLEHWLNPHCKPHCDRNRIHPV                               71 - 114
//

Text Mined References (8)

PMID Year Title