Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.00
PubTator Score 5.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.593 2.1e-06
diabetes mellitus -1.100 1.1e-03
lung carcinoma -1.300 1.0e-13
medulloblastoma, large-cell -1.700 1.7e-04
mucosa-associated lymphoid tissue lympho... 1.686 2.5e-02
non-small cell lung cancer -1.079 5.8e-12
ovarian cancer -1.700 9.6e-07
pancreatic cancer 2.000 7.6e-04
primary pancreatic ductal adenocarcinoma 1.949 5.5e-04

Gene RIF (5)

AA Sequence

MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFA      1 - 70
PVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSK     71 - 140
ENYNAKCVEQERLKKEGATQREIEKAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHL    141 - 210
IHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTVESLIQKFAESKGTGKERPGLIEFEECDTASAVE    211 - 280
GIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSIKPETNQNDTKENHFYSSSDSDSEDE    281 - 350
EPKKYRIEIKPMHPNNSHHTMASLDELKVSIGNITLSPAISRHSPVQMNRNLSNEELTKSKPSAPPNEKG    351 - 420
TSDLLAWDPLFGPSLDSSSSSSLTSSSSARPTTPLSVGTIVPPPRPASRPKLTSGKLSGINEIPRPFSPP    421 - 490
VTSNTSPPPAAPLARAESSSSISSSASLSAANTPTVGVSRGPSPVSLGNQDTLPVAVALTESVNAYFKGA    491 - 560
DPTKCIVKITGDMTMSFPSGIIKVFTSNPTPAVLCFRVKNISRLEQILPNAQLVFSDPSQCDSNTKDFWM    561 - 630
NMQAVTVYLKKLSEQNPAASYYNVDVLKYQVSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAP    631 - 700
SVLSNIQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKFDLSEGPSKPTTLA    701 - 770
VQFLSEGSTLSGVDFELVGTGYRLSLIKKRFATGRYLADC                                  771 - 810
//

Text Mined References (27)

PMID Year Title