Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
R01 Count 4
Funding $949,397.33
PubMed Score 4.91
PubTator Score 5.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (4)

PMID Text
25303365 The central linker of FCHO proteins acts as an allosteric regulator of the prime endocytic adaptor, AP-2.
22484487 show that the mu-homology domain of FCHO1/2 represents an endocytic interaction hub
22323290 FCHO2 regulates the size of clathrin structures, and its interaction with Dab2 is needed for LDLR endocytosis under conditions of low AP2.
17540576 This structure shows a distant relationship to curvature-sensing BAR modules, and suggests how similar coiled-coil architectures in the BAR superfamily have evolved to expand the repertoire of membrane-sculpting possibilities

AA Sequence

MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFA      1 - 70
PVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSK     71 - 140
ENYNAKCVEQERLKKEGATQREIEKAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHL    141 - 210
IHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTVESLIQKFAESKGTGKERPGLIEFEECDTASAVE    211 - 280
GIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSIKPETNQNDTKENHFYSSSDSDSEDE    281 - 350
EPKKYRIEIKPMHPNNSHHTMASLDELKVSIGNITLSPAISRHSPVQMNRNLSNEELTKSKPSAPPNEKG    351 - 420
TSDLLAWDPLFGPSLDSSSSSSLTSSSSARPTTPLSVGTIVPPPRPASRPKLTSGKLSGINEIPRPFSPP    421 - 490
VTSNTSPPPAAPLARAESSSSISSSASLSAANTPTVGVSRGPSPVSLGNQDTLPVAVALTESVNAYFKGA    491 - 560
DPTKCIVKITGDMTMSFPSGIIKVFTSNPTPAVLCFRVKNISRLEQILPNAQLVFSDPSQCDSNTKDFWM    561 - 630
NMQAVTVYLKKLSEQNPAASYYNVDVLKYQVSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAP    631 - 700
SVLSNIQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKFDLSEGPSKPTTLA    701 - 770
VQFLSEGSTLSGVDFELVGTGYRLSLIKKRFATGRYLADC                                  771 - 810
//

Text Mined References (25)

PMID Year Title
25303365 2014 A clathrin coat assembly role for the muniscin protein central linker revealed by TALEN-mediated gene editing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22323290 2012 FCH domain only-2 organizes clathrin-coated structures and interacts with Disabled-2 for low-density lipoprotein receptor endocytosis.
21762413 2011 Characterization of the EFC/F-BAR domain protein, FCHO2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20448150 2010 FCHo proteins are nucleators of clathrin-mediated endocytosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...