Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
R01 Count 4
Funding $384,239.33
PubMed Score 2.56
PubTator Score 46.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)
17628207 Molecular characterization and expression analysis of a novel member of the SLC10 family, SLC10A7, previously known as C4orf13, is reported
15932064 cloning and characterization; mapped to chromosome 4q31.2 and contains 12 exons; widely expressed in human tissues

AA Sequence

MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHL      1 - 70
KLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSA     71 - 140
FGSFLGIVITPLLLLLFLGSSSSVPFTSIFSQLFMTVVVPLIIGQIVRRYIKDWLERKKPPFGAISSSVL    141 - 210
LMIIYTTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSL    211 - 280
TLGIPMLKIVFAGHEHLSLISVPLLIYHPAQILLGSVLVPTIKSWMVSRQKKLLQTRGPLANLNNPEGLE    281 - 350
YLSIKFGH                                                                  351 - 358
//

Text Mined References (15)

PMID Year Title
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17628207 2007 Molecular and phylogenetic characterization of a novel putative membrane transporter (SLC10A7), conserved in vertebrates and bacteria.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15932064 2005 Molecular cloning and characterization of a novel human C4orf13 gene, tentatively a member of the sodium bile acid cotransporter family.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...