Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.56
PubTator Score 46.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Expression

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Pathway (1)

Gene RIF (3)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)
17628207 Molecular characterization and expression analysis of a novel member of the SLC10 family, SLC10A7, previously known as C4orf13, is reported
15932064 cloning and characterization; mapped to chromosome 4q31.2 and contains 12 exons; widely expressed in human tissues

AA Sequence

MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHL      1 - 70
KLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSA     71 - 140
FGSFLGIVITPLLLLLFLGSSSSVPFTSIFSQLFMTVVVPLIIGQIVRRYIKDWLERKKPPFGAISSSVL    141 - 210
LMIIYTTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSL    211 - 280
TLGIPMLKIVFAGHEHLSLISVPLLIYHPAQILLGSVLVPTIKSWMVSRQKKLLQTRGPLANLNNPEGLE    281 - 350
YLSIKFGH                                                                  351 - 358
//

Text Mined References (15)

PMID Year Title
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17628207 2007 Molecular and phylogenetic characterization of a novel putative membrane transporter (SLC10A7), conserved in vertebrates and bacteria.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15932064 2005 Molecular cloning and characterization of a novel human C4orf13 gene, tentatively a member of the sodium bile acid cotransporter family.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...