Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.52
PubTator Score 46.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (3)

AA Sequence

MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHL      1 - 70
KLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSA     71 - 140
FGSFLGIVITPLLLLLFLGSSSSVPFTSIFSQLFMTVVVPLIIGQIVRRYIKDWLERKKPPFGAISSSVL    141 - 210
LMIIYTTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSL    211 - 280
TLGIPMLKIVFAGHEHLSLISVPLLIYHPAQILLGSVLVPTIKSWMVSRQKKLLQTRGPLANLNNPEGLE    281 - 350
YLSIKFGH                                                                  351 - 358
//

Text Mined References (15)

PMID Year Title