Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.200 4.3e-09
ductal carcinoma in situ -2.000 7.5e-04
glioblastoma multiforme 1.200 9.8e-09
interstitial cystitis -1.100 4.3e-03
invasive ductal carcinoma -1.900 8.4e-03
medulloblastoma 1.100 8.9e-03
oligodendroglioma 1.600 3.7e-09

AA Sequence

MDELRWYHITVCLDHIFGHNCSLSCKDCMNGGKCQEGKSECSCPAGCRVILCNENCLEGAYGAGCTSECQ      1 - 70
CVEENTLECSAKNGSCTCKSGYQGNRCQKDGLWGPEGWFSSAPCENGGQCNKKTGNCDCTPDYTRKSCTI     71 - 140
LRCISLTNLALSRRSSPMKYQQNVSSHREVRQRQQCSSDRPFKKLLCKFSFKIGM                   141 - 195
//

Text Mined References (7)

PMID Year Title