Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.76
PubTator Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.5e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 5.5e-03

AA Sequence

MDSAACAAAATPVPALALALAPDLAQAPLALPGLLSPSCLLSSGQEVNGSERGTCLWRPWLSSTNDSPRQ      1 - 70
MRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRSFDYLYSAGEILLQNFPVQATINLYEDSDSEEEE     71 - 140
EDEEQEDEEEK                                                               141 - 151
//

Text Mined References (7)

PMID Year Title