Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.5e-03
Disease Target Count Z-score Confidence
oligodendroglioma 2850 3.607 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.500 1.5e-03

AA Sequence

MVRNVDDLDFHLPSHAQDMLDGLQRLRSQPKLADVTLLVGGRELPCHRGLLALSSPYFHAMFAGDFAESF      1 - 70
SARVELRDVEPAVVGQLVDFVYTGRLTITQGNVEALTRTAARLHFPSVQKVCGRYLQQQLDAANCLGICE     71 - 140
FGEQQGLLGVAAKAWAFLRENFEAVAREDEFLQLPRERLVTCLAGDLLQVQPEQSRLEALMRWVRHDPQA    141 - 210
RAAHLPELLSLVHLDAVPRPCVQQLLASEPLIQESEACRAALSQGHDGAPLALQQKLEEVLVVVGGQALE    211 - 280
EEEAGEEPTPGLGNFAFYNSKAKRWMALPDFPDYHKWGFSLAALNNNIYVTGGSRGTKTDTWSTTQAWCF    281 - 350
PLKEASWKPVAPMLKPRTNHASAALNGEIYVIGGTTLDVVEVESYDPYTDSWTPVSPALKYVSNFSAAGC    351 - 420
RGRLYLVGSSACKYNALALQCYNPVTDAWSVIASPFLPKYLSSPRCAALHGELYLIGDNTKKVYVYDPGA    421 - 490
NLWQKVQSQHSLHENGALVPLGDALYVTGGRWQGMEGDYHVEMEAYDTVRDTWTRHGALPRLWLYHGAST    491 - 560
VFLDVSKWTQPSGPTQEH                                                        561 - 578
//

Text Mined References (5)

PMID Year Title