Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.16
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q09FC8 F5H287 Q09FC7 Q09FC9 Q09FD0 Q6NSZ2 Q6P3S0 Q9NUR2
Symbols ZfLp

Gene

Gene RIF (2)

PMID Text
22863851 ZfLp is a zinc finger protein that functions as a drug carrier protein.
17055453 ZNF415 isoforms in COS-7 cells inhibits the transcriptional activities of AP-1 and p53, suggesting that the ZNF415 protein may be involved in AP-1- and p53-mediated transcriptional activity.

AA Sequence

MPELYTEDFIQGCDVGELQEPGLPGVLSYVGAQERALDHRKPSTSSKKTKRVEIDQRCENRLECNGAISA      1 - 70
HCNLRLPDSNDSPASASRVAGITDLSRNCVIKELAPQQEGNPGEVFHTVTLEQHEKHDIEEFCFREIKKK     71 - 140
IHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYEC    141 - 210
NHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMT    211 - 280
VRQVSHSGEKGYKCDLCGKVFSQKSNLARHWRVHTGEKPYKCNECDRSFSRNSCLALHRRVHTGEKPYKC    281 - 350
YECDKVFSRNSCLALHQKTHIGEKPYTCKECGKAFSVRSTLTNHQVIHSGKKPYKCNECGKVFSQTSSLA    351 - 420
THQRIHTGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKVFSYNSHLASHRRVHTGEKPYKC    421 - 490
NECGKAFSVHSNLTTHQVIHTGEKPYKCNQCGKGFSVHSSLTTHQVIHTGEKPYKCNECGKSFSVRPNLT    491 - 560
RHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN                               561 - 603
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22863851 2012 Functional characterization and substrate specificity of a novel gene encoding zinc finger-like protein, ZfLp, in Xenopus laevis oocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17055453 2006 A novel human gene ZNF415 with five isoforms inhibits AP-1- and p53-mediated transcriptional activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...