Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.16
PubTator Score 0.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 6.15429517551012E-7
atypical teratoid / rhabdoid tumor 4369 3.28031364969376E-6
colon cancer 1475 1.67082068922842E-5
adult high grade glioma 2148 3.4535563653966E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.68123283625432E-5
ovarian cancer 8492 6.76823848493109E-4
interstitial cystitis 2299 8.25801274783631E-4
glioblastoma 5572 8.28320245215486E-4
psoriasis 6685 0.00146153929598386
inflammatory breast cancer 404 0.0113868263477783
active Crohn's disease 918 0.0123720233866099
progressive supranuclear palsy 674 0.0187006731592702
cutaneous lupus erythematosus 1056 0.0190660298794198
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0275527262203545
active ulcerative colitis 477 0.0277973631834038
oligodendroglioma 2849 0.0355162250922945
head and neck cancer 270 0.0395506576115315

Expression

Synonym

Accession Q09FC8 F5H287 Q09FC7 Q09FC9 Q09FD0 Q6NSZ2 Q6P3S0 Q9NUR2
Symbols ZfLp

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
22863851 ZfLp is a zinc finger protein that functions as a drug carrier protein.
17055453 ZNF415 isoforms in COS-7 cells inhibits the transcriptional activities of AP-1 and p53, suggesting that the ZNF415 protein may be involved in AP-1- and p53-mediated transcriptional activity.

AA Sequence

MPELYTEDFIQGCDVGELQEPGLPGVLSYVGAQERALDHRKPSTSSKKTKRVEIDQRCENRLECNGAISA      1 - 70
HCNLRLPDSNDSPASASRVAGITDLSRNCVIKELAPQQEGNPGEVFHTVTLEQHEKHDIEEFCFREIKKK     71 - 140
IHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYEC    141 - 210
NHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMT    211 - 280
VRQVSHSGEKGYKCDLCGKVFSQKSNLARHWRVHTGEKPYKCNECDRSFSRNSCLALHRRVHTGEKPYKC    281 - 350
YECDKVFSRNSCLALHQKTHIGEKPYTCKECGKAFSVRSTLTNHQVIHSGKKPYKCNECGKVFSQTSSLA    351 - 420
THQRIHTGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKVFSYNSHLASHRRVHTGEKPYKC    421 - 490
NECGKAFSVHSNLTTHQVIHTGEKPYKCNQCGKGFSVHSSLTTHQVIHTGEKPYKCNECGKSFSVRPNLT    491 - 560
RHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN                               561 - 603
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22863851 2012 Functional characterization and substrate specificity of a novel gene encoding zinc finger-like protein, ZfLp, in Xenopus laevis oocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17055453 2006 A novel human gene ZNF415 with five isoforms inhibits AP-1- and p53-mediated transcriptional activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...