Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.16
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.429 1.2e-02
active ulcerative colitis -1.759 2.8e-02
adult high grade glioma -1.200 3.5e-05
atypical teratoid / rhabdoid tumor -1.100 3.3e-06
colon cancer -1.800 1.7e-05
cutaneous lupus erythematosus -1.100 1.9e-02
glioblastoma -1.400 8.3e-04
head and neck cancer -1.100 4.0e-02
inflammatory breast cancer -1.100 1.1e-02
interstitial cystitis -1.200 8.3e-04
intraductal papillary-mucinous adenoma (... -2.400 4.7e-05
intraductal papillary-mucinous carcinoma... -1.600 2.8e-02
medulloblastoma, large-cell -2.200 6.2e-07
oligodendroglioma -1.400 3.6e-02
ovarian cancer -1.200 6.8e-04
progressive supranuclear palsy -1.100 1.9e-02
psoriasis -1.200 8.9e-09

Gene RIF (2)

AA Sequence

MPELYTEDFIQGCDVGELQEPGLPGVLSYVGAQERALDHRKPSTSSKKTKRVEIDQRCENRLECNGAISA      1 - 70
HCNLRLPDSNDSPASASRVAGITDLSRNCVIKELAPQQEGNPGEVFHTVTLEQHEKHDIEEFCFREIKKK     71 - 140
IHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYEC    141 - 210
NHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMT    211 - 280
VRQVSHSGEKGYKCDLCGKVFSQKSNLARHWRVHTGEKPYKCNECDRSFSRNSCLALHRRVHTGEKPYKC    281 - 350
YECDKVFSRNSCLALHQKTHIGEKPYTCKECGKAFSVRSTLTNHQVIHSGKKPYKCNECGKVFSQTSSLA    351 - 420
THQRIHTGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKVFSYNSHLASHRRVHTGEKPYKC    421 - 490
NECGKAFSVHSNLTTHQVIHTGEKPYKCNQCGKGFSVHSSLTTHQVIHTGEKPYKCNECGKSFSVRPNLT    491 - 560
RHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN                               561 - 603
//

Text Mined References (14)

PMID Year Title