Property Summary

NCBI Gene PubMed Count 67
PubMed Score 133.70
PubTator Score 167.85

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
lung cancer 4473 1.07251219581354E-6
ovarian cancer 8492 2.92758629222398E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.7464971966964E-4
colon cancer 1475 4.74883801397347E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00100159329769399
osteosarcoma 7933 0.00285378463992419
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00438411363011792
active ulcerative colitis 477 0.0225961198116608
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.628 1.8



Accession Q09328 D3DP70
Symbols GNT-V


PANTHER Protein Class (2)

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (54)

26760037 binding of recombinant Gal-3 to the RPE cell surface and inhibitory effects on RPE attachment and spreading largely dependent on interaction with Mgat5 modified N-glycans
26583147 the level of TGFBR1 and early osteogenic differentiation were abolished in the DPSCs transfected with siRNA for GnT-V knockdown...GnT-V plays a critical role in the hexosamine-induced activation of TGF-b signaling and osteogenic differentiation
26531171 the knockdown of GnTV significantly suppressed the proliferation, migration and invasion (P<0.05) of the SMMC7721/R cells.
26349781 role in the inhibition of trophoblast cell invasion and migration during early pregnancy by direct or indirect regulation of MMP2/9 activity
26293457 Gnt-V caused tumour growth more quickly
26109616 Mgat5 plays an important role in early spontaneous miscarriage in humans.
26098720 MGAT5 protein and gene expression in in uveal and cutaneous melanoma cells
25944901 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
25876794 High expression of GnT-V was observed in infiltrating cells in skin section samples from systemic and localized patients with scleroderma.
25395405 Human Mgat5 increases amino acid uptake, intracellular levels of glycolytic and TCA intermediates, as well as HEK293 cell growth.

AA Sequence

HCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL                                 701 - 741

Text Mined References (67)

PMID Year Title
26760037 2016 Epithelial-to-Mesenchymal Transition of RPE Cells In Vitro Confers Increased ?1,6-N-Glycosylation and Increased Susceptibility to Galectin-3 Binding.
26583147 2015 Hexosamine-Induced TGF-? Signaling and Osteogenic Differentiation of Dental Pulp Stem Cells Are Dependent on N-Acetylglucosaminyltransferase V.
26531171 2016 Effect of GnT-V knockdown on the proliferation, migration and invasion of the SMMC7721/R human hepatocellular carcinoma drug-resistant cell line.
26349781 2015 N-acetylglucosaminyltransferase V inhibits the invasion of trophoblast cells by attenuating MMP2/9 activity in early human pregnancy.
26293457 2015 N-acetylglucosaminyltransferase V modulates radiosensitivity and migration of small cell lung cancer through epithelial-mesenchymal transition.
26109616 2015 Altered ?1,6-GlcNAc and bisecting GlcNAc-branched N-glycan on integrin ?1 are associated with early spontaneous miscarriage in humans.
26098720 2015 Diverse expression of N-acetylglucosaminyltransferase V and complex-type ?1,6-branched N-glycans in uveal and cutaneous melanoma cells.
25944901 2015 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
25876794 2015 Oligosaccharide modification by N-acetylglucosaminyltransferase-V in macrophages are involved in pathogenesis of bleomycin-induced scleroderma.
25395405 2015 Golgi N-glycan branching N-acetylglucosaminyltransferases I, V and VI promote nutrient uptake and metabolism.