Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 5
Funding $559,039.75
PubMed Score 15.81
PubTator Score 83.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 3.300 0.000
posterior fossa group B ependymoma -2.000 0.000
osteosarcoma -2.673 0.000
glioblastoma -2.100 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.100 0.012
intraductal papillary-mucinous carcinoma... 1.100 0.006
lung cancer -1.600 0.001
breast carcinoma -1.200 0.001
adult high grade glioma -2.000 0.000
lung adenocarcinoma -3.600 0.000
pituitary cancer 1.100 0.000
psoriasis -1.100 0.000

Gene RIF (14)

PMID Text
26801611 High expression of alpha2,6-sialylation on the cell surface could affect the anti-migratory role of GnT-III, which provides an insight into the mechanistic roles of GnT-III in tumor metastasis.
26109616 Mgat3 plays an important role in early spontaneous miscarriage in humans.
26098720 MGAT3 protein and gene expression in in uveal and cutaneous melanoma cells
25936519 HS5 cells had significantly enhanced levels of bisecting N-glycans (catalyzed by MGAT3 whereas HS27a cells had enhanced levels of Galbeta1,4GlcNAc.
24726881 functional characterization of N-acetylglucosaminyltransferases III and V in human melanoma cells
23671930 GnT-III determines E-cadherin-mediated tumor suppression, and GnT-V regulates E-cadherin-mediated tumor invasion.
22451656 Roles of N-acetylglucosaminyltransferase III in epithelial-to-mesenchymal transition induced by transforming growth factor beta1 (TGF-beta1) in epithelial cell lines
21368380 MGAT3 mRNA biomarker may characterize subgroups of Alzheimer's disease patients with different disease progression.
20089585 the modulation of glycosyltransferases MGAT3 and MGAT5 by synthetic N-acetyl-D-glucosamine-calix[4]arene correlated with the improvement of NK cell effector functions and the augmentation of tumor cells sensitivity to NK cell-mediated cytotoxicity.
19776078 upregulation of GnT-III in AD brains may represent an adaptive response to protect them from additional beta-amyloid production
More...

AA Sequence

MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQASPEPGGPDLL      1 - 70
RTPLYSHSPLLQPLPPSKAAEELHRVDLVLPEDTTEYFVRTKAGGVCFKPGTKMLERPPPGRPEEKPEGA     71 - 140
NGSSARRPPRYLLSARERTGGRGARRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVIN    141 - 210
AINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPG    211 - 280
GRQDGWIADDYLRTFLTQDGVSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYG    281 - 350
FFWKQPGTLEVVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCS    351 - 420
WCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKN    421 - 490
YDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV                               491 - 533
//

Text Mined References (28)

PMID Year Title
26801611 2016 Expression of N-Acetylglucosaminyltransferase III Suppresses ?2,3-Sialylation, and Its Distinctive Functions in Cell Migration Are Attributed to ?2,6-Sialylation Levels.
26109616 2015 Altered ?1,6-GlcNAc and bisecting GlcNAc-branched N-glycan on integrin ?1 are associated with early spontaneous miscarriage in humans.
26098720 2015 Diverse expression of N-acetylglucosaminyltransferase V and complex-type ?1,6-branched N-glycans in uveal and cutaneous melanoma cells.
25936519 2015 Quantitative analysis of glycans, related genes, and proteins in two human bone marrow stromal cell lines using an integrated strategy.
24726881 2014 Overexpression of N-acetylglucosaminyltransferases III and V in human melanoma cells. Implications for MCAM N-glycosylation.
23671930 2013 E-cadherin and adherens-junctions stability in gastric carcinoma: functional implications of glycosyltransferases involving N-glycan branching biosynthesis, N-acetylglucosaminyltransferases III and V.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22451656 2012 Roles of N-acetylglucosaminyltransferase III in epithelial-to-mesenchymal transition induced by transforming growth factor ?1 (TGF-?1) in epithelial cell lines.
21368380 2011 MGAT3 mRNA: a biomarker for prognosis and therapy of Alzheimer's disease by vitamin D and curcuminoids.
20089585 2010 Glycosylation regulates NK cell-mediated effector function through PI3K pathway.
More...