Property Summary

Ligand Count 11
NCBI Gene PubMed Count 31
PubMed Score 17.33
PubTator Score 83.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.000 3.5e-08
atypical teratoid / rhabdoid tumor -2.100 1.8e-11
breast carcinoma -1.200 1.1e-03
ependymoma -1.400 1.4e-02
glioblastoma -1.500 2.3e-08
group 4 medulloblastoma -1.300 1.5e-05
intraductal papillary-mucinous carcinoma... 1.100 5.5e-03
lung adenocarcinoma -2.000 4.5e-13
lung cancer -1.600 6.8e-04
malignant mesothelioma 3.300 3.8e-08
medulloblastoma, large-cell -2.000 6.2e-07
osteosarcoma -2.673 3.4e-08
pituitary cancer 1.100 7.8e-06
primitive neuroectodermal tumor -1.100 1.2e-02
psoriasis -1.100 1.5e-42

Gene RIF (17)

AA Sequence

MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQASPEPGGPDLL      1 - 70
RTPLYSHSPLLQPLPPSKAAEELHRVDLVLPEDTTEYFVRTKAGGVCFKPGTKMLERPPPGRPEEKPEGA     71 - 140
NGSSARRPPRYLLSARERTGGRGARRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVIN    141 - 210
AINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPG    211 - 280
GRQDGWIADDYLRTFLTQDGVSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYG    281 - 350
FFWKQPGTLEVVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCS    351 - 420
WCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKN    421 - 490
YDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV                               491 - 533
//

Text Mined References (31)

PMID Year Title