Property Summary

NCBI Gene PubMed Count 62
PubMed Score 207.70
PubTator Score 44.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.166 6.0e-07
Breast cancer 1.400 1.2e-14
breast carcinoma 1.200 8.4e-27
ependymoma 1.500 2.6e-02
intraductal papillary-mucinous carcinoma... 1.100 5.2e-03
malignant mesothelioma 1.300 2.1e-06
medulloblastoma 1.100 2.2e-05
non-small cell lung cancer 1.013 4.2e-13
tuberculosis and treatment for 3 months -1.100 2.5e-04

Protein-protein Interaction (2)

Gene RIF (14)

AA Sequence

MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILR      1 - 70
LLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVI     71 - 140
AAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTH    141 - 210
VPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDS    211 - 280
VYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYH    281 - 350
IVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHH    351 - 420
LSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDE    421 - 490
SSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNPLKIEVFVQTLLHLAAKSFS    491 - 560
HSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSR    561 - 630
DFTRLFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVE    631 - 700
SAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLF    701 - 770
TAELDPHILAVFQQFCALQA                                                      771 - 790
//

Text Mined References (76)

PMID Year Title