Property Summary

NCBI Gene PubMed Count 91
Grant Count 10
R01 Count 1
Funding $814,340.4
PubMed Score 51.83
PubTator Score 467.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 3.496 0.000
group 3 medulloblastoma 1.600 0.006
subependymal giant cell astrocytoma -1.805 0.011
Pick disease 1.300 0.000
ovarian cancer -2.400 0.000

Gene RIF (20)

PMID Text
26491019 RBBP4 functions as a novel regulatory factor to increase the efficiency of importin alpha/beta-mediated nuclear import
26376479 RbAp48 was identified as critical in the proliferation of hypopharyngeal carcinoma in both in vitro and in vivo experiments.
25601084 Our RBBP4-PHF6 complex structure provides insights into the molecular basis of PHF6-NuRD complex interaction and implicates a role for PHF6 in chromatin structure modulation and gene regulation.
25165715 Our results reveal that the protein structure does not affect ligand binding, and the top three TCM candidates Bittersweet alkaloid II, Eicosandioic acid, and Perivine might resolve the instability of the RbAp48-FOG1 complex
25150575 It is associated with episodic memory performance.
24920672 RbAp48 recognizes MTA1 using the same site that it uses to bind histone H4, showing that assembly into NuRD modulates RbAp46/48 interactions with histones.
23986399 The most significant change was an age-related decline in RbAp48, a histone-binding protein that modifies histone acetylation.
23178455 study of the interaction of the histone H3-H4 complex with the RbAp48 and their exchange with a second histone chaperone, anti-silencing function protein 1 (ASF1); exchange of histones H3-H4 between these two histone chaperones has a central role in the assembly of new nucleosomes
21689726 Data identified RBBP4 and RBBP9 as required for maintenance of multiple PS cell types, and both RBBPs were bound to RB in PS cells.
21047798 The FOG-1 peptide contacts a negatively charged binding pocket on top of the RbAp48 beta-propeller that is distinct from the binding surface used by RpAp48 to contact histone H4
More...

AA Sequence

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGT      1 - 70
HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCII     71 - 140
ATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV    141 - 210
PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLS    211 - 280
FNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKI    281 - 350
GEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP    351 - 420
EGQGS                                                                     421 - 425
//

Text Mined References (103)

PMID Year Title
27144666 2016 The MTA1 subunit of the nucleosome remodeling and deacetylase complex can recruit two copies of RBBP4/7.
26491019 2015 Retinoblastoma-binding Protein 4-regulated Classical Nuclear Transport Is Involved in Cellular Senescence.
26376479 2015 RbAp48 Is Critical for the Proliferation of Hypopharyngeal Carcinoma.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25601084 2015 Structural basis of plant homeodomain finger 6 (PHF6) recognition by the retinoblastoma binding protein 4 (RBBP4) component of the nucleosome remodeling and deacetylase (NuRD) complex.
25416956 2014 A proteome-scale map of the human interactome network.
25165715 2014 Lead discovery for Alzheimer's disease related target protein RbAp48 from traditional Chinese medicine.
25150575 2014 Genetic variants in a 'cAMP element binding protein' (CREB)-dependent histone acetylation pathway influence memory performance in cognitively healthy elderly individuals.
24920672 2014 Insight into the architecture of the NuRD complex: structure of the RbAp48-MTA1 subcomplex.
More...