Property Summary

NCBI Gene PubMed Count 95
PubMed Score 53.88
PubTator Score 467.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.0e-07
osteosarcoma 7950 1.2e-06
group 3 medulloblastoma 4104 6.4e-05
Pick disease 1894 1.9e-03
subependymal giant cell astrocytoma 2287 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Retinoblastoma 19 4.625 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.400 6.4e-05
osteosarcoma -1.726 1.2e-06
ovarian cancer -1.300 2.0e-07
Pick disease 1.200 1.9e-03
subependymal giant cell astrocytoma -1.805 1.1e-02

Protein-protein Interaction (3)

Gene RIF (24)

AA Sequence

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGT      1 - 70
HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCII     71 - 140
ATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV    141 - 210
PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLS    211 - 280
FNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKI    281 - 350
GEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP    351 - 420
EGQGS                                                                     421 - 425
//

Text Mined References (108)

PMID Year Title