Property Summary

NCBI Gene PubMed Count 15
PubMed Score 58.55
PubTator Score 6.64

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.200 3.7e-02
atypical teratoid / rhabdoid tumor 1.200 3.4e-04
group 3 medulloblastoma -1.300 1.4e-02
osteosarcoma 1.335 6.6e-05
psoriasis -1.400 1.1e-04

Synonym

Accession Q09019
Symbols DMRN9
DMR-N9
gene59
D19S593E

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAGGAEGGSGPGAAMGDCAEIKSQFRTREGFYKLLPGDGAARRSGPASAQTPVPPQPPQPPPGPASASG      1 - 70
PGAAGPASSPPPAGPGPGPALPAVRLSLVRLGEPDSAGAGEPPATPAGLGSGGDRVCFNLGRELYFYPGC     71 - 140
CRRGSQRSIDLNKPIDKRIYKGTQPTCHDFNQFTAATETISLLVGFSAGQVQYLDLIKKDTSKLFNEERL    141 - 210
IDKTKVTYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYAAKSKAPRNPLAKW    211 - 280
AVGEGPLNEFAFSPDGRHLACVSQDGCLRVFHFDSMLLRGLMKSYFGGLLCVCWSPDGRYVVTGGEDDLV    281 - 350
TVWSFTEGRVVARGHGHKSWVNAVAFDPYTTRAEEAATAAGADGERSGEEEEEEPEAAGTGSAGGAPLSP    351 - 420
LPKAGSITYRFGSAGQDTQFCLWDLTEDVLYPHPPLARTRTLPGTPGTTPPAASSSRGGEPGPGPLPRSL    421 - 490
SRSNSLPHPAGGGKAGGPGVAAEPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGSGSG    491 - 560
GEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWAR    561 - 630
PGKAFTDEETEAQTGEGSWPRSPSKSVVEGISSQPGNSPSGTVV                              631 - 674
//

Text Mined References (18)

PMID Year Title