Property Summary

NCBI Gene PubMed Count 14
Grant Count 8
R01 Count 5
Funding $697,392.49
PubMed Score 56.10
PubTator Score 6.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.200 0.037
psoriasis -1.400 0.000
osteosarcoma 1.606 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
group 3 medulloblastoma -1.300 0.014

AA Sequence

MAAGGAEGGSGPGAAMGDCAEIKSQFRTREGFYKLLPGDGAARRSGPASAQTPVPPQPPQPPPGPASASG      1 - 70
PGAAGPASSPPPAGPGPGPALPAVRLSLVRLGEPDSAGAGEPPATPAGLGSGGDRVCFNLGRELYFYPGC     71 - 140
CRRGSQRSIDLNKPIDKRIYKGTQPTCHDFNQFTAATETISLLVGFSAGQVQYLDLIKKDTSKLFNEERL    141 - 210
IDKTKVTYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYAAKSKAPRNPLAKW    211 - 280
AVGEGPLNEFAFSPDGRHLACVSQDGCLRVFHFDSMLLRGLMKSYFGGLLCVCWSPDGRYVVTGGEDDLV    281 - 350
TVWSFTEGRVVARGHGHKSWVNAVAFDPYTTRAEEAATAAGADGERSGEEEEEEPEAAGTGSAGGAPLSP    351 - 420
LPKAGSITYRFGSAGQDTQFCLWDLTEDVLYPHPPLARTRTLPGTPGTTPPAASSSRGGEPGPGPLPRSL    421 - 490
SRSNSLPHPAGGGKAGGPGVAAEPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGSGSG    491 - 560
GEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWAR    561 - 630
PGKAFTDEETEAQTGEGSWPRSPSKSVVEGISSQPGNSPSGTVV                              631 - 674
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14526185 2003 Transgenic mouse models for myotonic dystrophy type 1 (DM1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11592825 Effect of triplet repeat expansion on chromatin structure and expression of DMPK and neighboring genes, SIX5 and DMWD, in myotonic dystrophy.
11527424 2001 Decreased DMPK transcript levels in myotonic dystrophy 1 type IIA muscle fibers.
More...