Property Summary

Ligand Count 1
NCBI Gene PubMed Count 137
PubMed Score 496.64
PubTator Score 1097.27

Knowledge Summary

Patent (13,790)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Myotonia 10 0.0 0.0
Myotonic Dystrophy 3 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Myotonic dystrophy type 1 17 7.504 3.8

Expression

  Differential Expression (11)

Disease log2 FC p
diabetes mellitus -1.200 3.5e-03
acute quadriplegic myopathy 1.008 7.1e-05
Amyotrophic lateral sclerosis 1.132 1.4e-04
astrocytic glioma 1.100 6.7e-03
Astrocytoma, Pilocytic 1.100 1.5e-03
atypical teratoid / rhabdoid tumor 1.100 1.9e-03
dermatomyositis -1.200 2.2e-03
ependymoma 1.600 6.5e-04
glioblastoma 1.300 4.2e-05
juvenile dermatomyositis 1.112 8.7e-07
psoriasis -2.500 7.0e-06

Gene RIF (97)

AA Sequence

MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDD      1 - 70
FEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVLVNGDRRWITQLHFAFQD     71 - 140
ENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIR    141 - 210
LADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYA    211 - 280
DSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDS    281 - 350
VPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP    351 - 420
MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREME    421 - 490
AIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATDPPSHLDGPPAVAVGQ    491 - 560
CPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVVLSRAAALGCIGLVAHAGQLTAVWRRPGAARAP     561 - 629
//

Text Mined References (140)

PMID Year Title