Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
IGA Glomerulonephritis 454 3.161 1.6

Expression

Synonym

Accession Q08ER8 Q495U9 Q495V0 Q6ZMP4 Q8NCX4
Symbols

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26095808 Data indicate 3 variants in 3 novel genes myc target 1 protein (MYCT1), caspase recruitment domain family member 8 (CARD8) and zinc finger protein 543 (ZNF543), associated with familial IgA nephropathy (IgAN).

AA Sequence

MAASAQVSVTFEDVAVTFTQEEWGQLDAAQRTLYQEVMLETCGLLMSLGCPLFKPELIYQLDHRQELWMA      1 - 70
TKDLSQSSYPGDNTKPKTTEPTFSHLALPEEVLLQEQLTQGASKNSQLGQSKDQDGPSEMQEVHLKIGIG     71 - 140
PQRGKLLEKMSSERDGLGSDDGVCTKITQKQVSTEGDLYECDSHGPVTDALIREEKNSYKCEECGKVFKK    141 - 210
NALLVQHERIHTQVKPYECTECGKTFSKSTHLLQHLIIHTGEKPYKCMECGKAFNRRSHLTRHQRIHSGE    211 - 280
KPYKCSECGKAFTHRSTFVLHHRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHTGEKPYECIECGKAFNR    281 - 350
RSYLTWHQQIHTGVKPFECNECGKAFCESADLIQHYIIHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGE    351 - 420
KPYECSECGKAFTHCSTFVLHKRTHTGEKPYECKECGKAFSDRADLIRHFSIHTGEKPYECVECGKAFNR    421 - 490
SSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEKPYECSECGKAFNRGSSLTHHQRIHTGR    491 - 560
NPTIVTDVGRPFMTAQTSVNIQELLLGKEFLNITTEENLW                                  561 - 600
//

Text Mined References (8)

PMID Year Title
26095808 2015 Novel genes and variants associated with IgA nephropathy by co-segregating with the disease phenotypes in 10 IgAN families.
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.