Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q08E93
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGIFQLLRDRRISSRGPGLHTPKAEPRRRKGLTTGLMTQAERQKQAHQRQAAMRETALWCTGHIRPRTHT      1 - 70
HTGTHTQTDRERERNTQRLRDRERRENGRHTHTYTHRHTHRVL                                71 - 113
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.