Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
cystic fibrosis 1670 0.00110022794993321
psoriasis 6685 0.0048485846439318
esophageal adenocarcinoma 737 0.0195207517873976
spina bifida 1064 0.035817889435841

Expression

  Differential Expression (4)

Disease log2 FC p
esophageal adenocarcinoma -1.900 0.020
psoriasis -1.400 0.005
cystic fibrosis 1.300 0.001
spina bifida -1.279 0.036

Synonym

Accession Q08AI8 B3KPP9 H7BXM3 Q08AI9 Q53QU5 Q9H622
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

AA Sequence

MPAPALPTSAMAVQVPLWHHYLQAIRSREAPRAQDFQRAENVLLTVLERVHALDPRFIVDYSRGLEAFQF      1 - 70
ALRSSEDPMDMEVPLWVDAEALLIEEPEATQPEDGLELCHLGVPREGAGLERWTTEDTFTASSEGDAKCR     71 - 140
GHIVPSKVLCVLKDLLVAAIVHCKHHSLIAPGSLNAASLREEQLHLSLLVSSGWRTISFHVVPVVRRKLG    141 - 210
APALEGVQQMPGFPEGSLRRILSQGVDLVPASAQLWRTSTDYLLTRLLGELGSLQGHRLDSLSILDRVNH    211 - 280
ESWRDSGQTDGLTFGHLKMVLLWASVLFLAPEDWAELQGAVYRLLVVLLCCLATRKLPHFLHPQRNLLQG    281 - 350
SGLDLGAIYQRVEGFASQPEAALRIHATHLGRSPPPRIGSGLKALLQLPASDPTYWATAYFDVLLDKFQV    351 - 420
FNIQDKDRISAMQSIFQKTRTLGGEES                                               421 - 447
//

Text Mined References (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.