Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1696 1.1e-03
psoriasis 6694 4.8e-03
esophageal adenocarcinoma 737 2.0e-02
spina bifida 1074 3.6e-02

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.300 1.1e-03
esophageal adenocarcinoma -1.900 2.0e-02
psoriasis -1.400 4.8e-03
spina bifida -1.279 3.6e-02

AA Sequence

MPAPALPTSAMAVQVPLWHHYLQAIRSREAPRAQDFQRAENVLLTVLERVHALDPRFIVDYSRGLEAFQF      1 - 70
ALRSSEDPMDMEVPLWVDAEALLIEEPEATQPEDGLELCHLGVPREGAGLERWTTEDTFTASSEGDAKCR     71 - 140
GHIVPSKVLCVLKDLLVAAIVHCKHHSLIAPGSLNAASLREEQLHLSLLVSSGWRTISFHVVPVVRRKLG    141 - 210
APALEGVQQMPGFPEGSLRRILSQGVDLVPASAQLWRTSTDYLLTRLLGELGSLQGHRLDSLSILDRVNH    211 - 280
ESWRDSGQTDGLTFGHLKMVLLWASVLFLAPEDWAELQGAVYRLLVVLLCCLATRKLPHFLHPQRNLLQG    281 - 350
SGLDLGAIYQRVEGFASQPEAALRIHATHLGRSPPPRIGSGLKALLQLPASDPTYWATAYFDVLLDKFQV    351 - 420
FNIQDKDRISAMQSIFQKTRTLGGEES                                               421 - 447
//

Text Mined References (4)

PMID Year Title