Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
esophageal adenocarcinoma -1.900 0.020
psoriasis -1.400 0.005
cystic fibrosis 1.300 0.001
spina bifida -1.279 0.036

AA Sequence

MPAPALPTSAMAVQVPLWHHYLQAIRSREAPRAQDFQRAENVLLTVLERVHALDPRFIVDYSRGLEAFQF      1 - 70
ALRSSEDPMDMEVPLWVDAEALLIEEPEATQPEDGLELCHLGVPREGAGLERWTTEDTFTASSEGDAKCR     71 - 140
GHIVPSKVLCVLKDLLVAAIVHCKHHSLIAPGSLNAASLREEQLHLSLLVSSGWRTISFHVVPVVRRKLG    141 - 210
APALEGVQQMPGFPEGSLRRILSQGVDLVPASAQLWRTSTDYLLTRLLGELGSLQGHRLDSLSILDRVNH    211 - 280
ESWRDSGQTDGLTFGHLKMVLLWASVLFLAPEDWAELQGAVYRLLVVLLCCLATRKLPHFLHPQRNLLQG    281 - 350
SGLDLGAIYQRVEGFASQPEAALRIHATHLGRSPPPRIGSGLKALLQLPASDPTYWATAYFDVLLDKFQV    351 - 420
FNIQDKDRISAMQSIFQKTRTLGGEES                                               421 - 447
//

Text Mined References (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.