Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.100 1.9e-02
intraductal papillary-mucinous adenoma (... -1.100 9.5e-03
lung carcinoma 3.000 1.6e-31
medulloblastoma, large-cell -1.200 3.5e-02
subependymal giant cell astrocytoma 3.022 2.3e-02

Gene RIF (1)

AA Sequence

MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQFLYPFIAMISY      1 - 70
NIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAKLGKVSLISTGLTTLILGIVM     71 - 140
ARAISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHMSIVISVFI    141 - 210
CIFFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFVTREVIANVFFGGNLSSVF    211 - 280
HIVVTVMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGA    281 - 350
VVMVFGFVMAITNTQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSTLNISIFQ                  351 - 406
//

Text Mined References (7)

PMID Year Title