Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q08AF8 A4FTY1 Q1A5X9 Q8NDK0
Symbols

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 11 is discussed

AA Sequence

MEWKLEQSMREQALLKAQLTQLKESLKEVQLERDEYAEHLKGERARWQQRMRKMSQEVCSLKKEKKHDKY      1 - 70
RVEKLERSLSKLKHQMAEPLPPEPPAVPSEVELQHLRKELERVAGELQAQVEYNQRISLLNEGQKERLRE     71 - 140
QEERLQEQQERLPEQEERLQQLAEPQNSFKELNNENKSVLQLEQQVKELQEKLGKERLEAASQQKQQLTA    141 - 210
QLSLMALPGEGDGGGHLDSEGEEAPRPIPSIPQDLESREAMSGFMDHLEEKADLSELVEKEELGFFQYYR    211 - 280
ERCHQKVYHPITKPGGSAKDAAPGGGHHQAGPGQGGDEGEAAGAAGDGVAAGGDYKGHSKFLVTAQNPAH    281 - 350
EPSPGAPAPQELGAAHKHGDLCEVSLTDSVEPVQGEAREGSPHDNPTAQPIVQDHQEHPGLGSNCCVPFF    351 - 420
CWAWLPRRRR                                                                421 - 430
//

Text Mined References (8)

PMID Year Title
18226259 2008 Genomic analysis of the chromosome 15q11-q13 Prader-Willi syndrome region and characterization of transcripts for GOLGA8E and WHCD1L1 from the proximal breakpoint region.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.