Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 2.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.180 9.7e-07
atypical teratoid / rhabdoid tumor 1.100 1.7e-04
cystic fibrosis 1.946 2.0e-05
ependymoma 1.400 1.3e-02
glioblastoma 1.300 6.3e-03
hepatocellular carcinoma 1.100 3.1e-04
juvenile dermatomyositis 1.398 1.7e-07
lung carcinoma -2.500 3.4e-24
oligodendroglioma 1.100 5.1e-03
osteosarcoma 1.858 2.9e-06
ovarian cancer 1.200 1.1e-02
pancreatic ductal adenocarcinoma liver m... 2.244 2.2e-03
pediatric high grade glioma 1.100 2.0e-03
Pick disease 1.300 2.9e-06
primary Sjogren syndrome 1.300 9.5e-04
psoriasis 1.100 2.9e-04
sarcoidosis 1.100 1.3e-02
subependymal giant cell astrocytoma 1.059 4.8e-02
tuberculosis -1.200 1.5e-03
ulcerative colitis 1.200 1.0e-03

 GO Function (1)

 GO Component (1)

 GO Process (1)

Gene RIF (5)

AA Sequence

MSLRIDVDTNFPECVVDAGKVTLGTQQRQEMDPRLREKQNEIILRAVCALLNSGGGIIKAEIENKGYNYE      1 - 70
RHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNTEAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKCR     71 - 140
TQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAALFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVKD    141 - 210
RLPKCVSAFANTEGGYVFFGVHDETCQVIGCEKEKIDLTSLRASIDGCIKKLPVHHFCTQRPEIKYVLNF    211 - 280
LEVHDKGALRGYVCAIKVEKFCCAVFAKVPSSWQVKDNRVRQLPTREWTAWMMEADPDLSRCPEMVLQLS    281 - 350
LSSATPRSKPVCIHKNSECLKEQQKRYFPVFSDRVVYTPESLYKELFSQHKGLRDLINTEMRPFSQGILI    351 - 420
FSQSWAVDLGLQEKQGVICDALLISQNNTPILYTIFSKWDAGCKGYSMIVAYSLKQKLVNKGGYTGRLCI    421 - 490
TPLVCVLNSDRKAQSVYSSYLQIYPESYNFMTPQHMEALLQSLVIVLLGFKSFLSEELGSEVLNLLTNKQ    491 - 560
YELLSKNLRKTRELFVHGLPGSGKTILALRIMEKIRNVFHCEPANILYICENQPLKKLVSFSKKNICQPV    561 - 630
TRKTFMKNNFEHIQHIIIDDAQNFRTEDGDWYGKAKFITQTARDGPGVLWIFLDYFQTYHLSCSGLPPPS    631 - 700
DQYPREEINRVVRNAGPIANYLQQVMQEARQNPPPNLPPGSLVMLYEPKWAQGVPGNLEIIEDLNLEEIL    701 - 770
IYVANKCRFLLRNGYSPKDIAVLFTKASEVEKYKDRLLTAMRKRKLSQLHEESDLLLQIGDASDVLTDHI    771 - 840
VLDSVCRFSGLERNIVFGINPGVAPPAGAYNLLLCLASRAKRHLYILKASV                       841 - 891
//

Text Mined References (11)

PMID Year Title