Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.60
PubTator Score 7.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 1.384 4.5e-02
aldosterone-producing adenoma -1.104 1.7e-02
atypical teratoid / rhabdoid tumor -1.600 8.2e-06
glioblastoma 1.100 2.1e-02
group 4 medulloblastoma 1.100 1.8e-02
medulloblastoma, large-cell -1.600 7.5e-07
oligodendroglioma 1.100 4.1e-02
osteosarcoma 2.376 3.5e-05
ovarian cancer -1.500 2.6e-03
tuberculosis -1.100 3.0e-05

 GO Function (1)

Gene RIF (10)

AA Sequence

MAQAAGPAGGGEPRTEAVGGEGPREPGAAGGAAGGSRDALSLEEILRLYNQPINEEQAWAVCYQCCGSLR      1 - 70
AAARRRQPRHRVRSAAQIRVWRDGAVTLAPAADDAGEPPPVAGKLGYSQCMETEVIESLGIIIYKALDYG     71 - 140
LKENEERELSPPLEQLIDHMANTVEADGSNDEGYEAAEEGLGDEDEKRKISAIRSYRDVMKLCAAHLPTE    141 - 210
SDAPNHYQAVCRALFAETMELHTFLTKIKSAKENLKKIQEMEKSDESSTDLEELKNADWARFWVQVMRDL    211 - 280
RNGVKLKKVQERQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVMVNGDIPPRLKKSAHEIILDFIRSRPP    281 - 350
LNPVSARKLKPTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLAMRPLSMSYSFDLSDVTTPESTKN    351 - 420
LVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHKSTSSSSVSPSFPEEPV    421 - 490
LEAVSTRKKPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRSLEEFCYPVECLALTV    491 - 560
EEVMHIRQVLVKAELEKYQQYKDIYTALKKGKLCFCCRTRRFSFFTWSYTCQFCKRPVCSQCCKKMRLPS    561 - 630
KPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTME    631 - 700
VCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI                  701 - 756
//

Text Mined References (27)

PMID Year Title