Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.80
PubTator Score 7.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.400 1.0e-04
atypical teratoid / rhabdoid tumor -2.000 2.8e-07
ependymoma -1.400 5.1e-09
glioblastoma -1.300 1.4e-02
intraductal papillary-mucinous adenoma (... 1.300 4.9e-02
juvenile dermatomyositis 1.096 9.8e-10
medulloblastoma -1.100 8.9e-05
medulloblastoma, large-cell -1.800 6.6e-06
mucosa-associated lymphoid tissue lympho... 1.542 3.7e-02
osteosarcoma 1.219 2.0e-03
ovarian cancer -1.900 4.8e-07
pancreatic cancer 1.300 3.0e-03
primary pancreatic ductal adenocarcinoma 1.012 3.3e-02
psoriasis -2.300 8.4e-05
tuberculosis -1.700 2.4e-05

Gene RIF (6)

AA Sequence

MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELQEPFYTDQYDQEHIKPP      1 - 70
VVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKLVTERDLHKKPIQMSAHLAMI     71 - 140
DTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDAVMYWINKVNEHLKDIMEQEQKLKEHHTVEA    141 - 210
PGGQKSPSKWFWKLVPARYRKEQTLLKQLPCIPLVENLLKDGTDGCALAALIHFYCPDVVRLEDICLKET    211 - 280
MSLADSLYNLQLIQEFCQEYLNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQ    281 - 350
GAEPVKDMPSIPVLNAAKRNVLDSSSDFPSSGEGATFTQSHHHLPSRYSRPQAHSSASGGIRRSSSMSYV    351 - 420
DGFIGTWPKEKRSSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPING    421 - 490
EEEAESIEEELNIDSHSDLKSCVPLNTNELNSNENIHYKLPNGALQNRILLDEFGNQIETPSIEEALQII    491 - 560
HDTEKSPHTPQPDQIANGFFLHSQEMSILNSNIKLNQSSPDNVTDTKGALSPITDNTEVDTGIHVPSEDI    561 - 630
PETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRTGNTREALSPCPSTVSTKSQPGSSASSSSGVKMTSF    631 - 700
AEQKFRKLNHTDGKSSGSSSQKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEE    701 - 770
KRRAIEAQKKKMEAAFTKQRQKMGRTAFLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKESQKTDGQ    771 - 840
RSKSLADIKESMENPQAKWLKSPTTPIDPEKQWNLASPSEETLNEGEILEYTKSIEKLNSSLHFLQQEMQ    841 - 910
RLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSKQAGLSSAIAPFSSDSPRPTHPSPQSSNRKSAS    911 - 980
FSVKSQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQTRSFVCFGDDGEPQLKESKPKEEV    981 - 1050
KKEELESKGTLEQRGHNPEEKEIKPFESTVSEVLSLPVTETVCLTPNEDQLNQPTEPPPKPVFPPTAPKN   1051 - 1120
VNLIEVSLSDLKPPEKADVPVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRRE   1121 - 1190
KETQLRKQQLEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVVK   1191 - 1260
QKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSPSRCGSRNGEK   1261 - 1330
DWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLI   1331 - 1400
LFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHS   1401 - 1470
HLWQTKRPVTPKKLLPTKA                                                      1471 - 1489
//

Text Mined References (31)

PMID Year Title