Property Summary

NCBI Gene PubMed Count 115
Grant Count 385
R01 Count 242
Funding $28,935,199.21
PubMed Score 505.27
PubTator Score 279.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.018
pancreatic cancer -1.300 0.018
Waldenstrons macroglobulinemia 1.262 0.001
astrocytic glioma 1.200 0.006
ependymoma 1.400 0.001
oligodendroglioma 1.500 0.001
psoriasis -1.400 0.019
atypical teratoid / rhabdoid tumor 1.800 0.000
glioblastoma 1.300 0.001
medulloblastoma 1.200 0.011
medulloblastoma, large-cell 1.400 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.005
lung cancer -1.300 0.001
pancreatic carcinoma -1.300 0.018
ovarian cancer -1.700 0.000

Synonym

Accession Q08999 B7Z913 Q15073 Q16084 Q8NE70 Q92812
Symbols Rb2
P130

Gene

PANTHER Protein Class (1)

PDB

4XI9   5C1D  

Gene RIF (72)

PMID Text
26576645 Hepatitis C virus core protein modulates pRb2/p130 expression in human hepatocellular carcinoma cell lines through promoter methylation
26271034 Statistical analysis revealed that Rbl2/p130 expression negatively correlates to its promoter methylation (r = -0.412) in tumor tissues.
25183046 TGF-beta induced RBL2 expression through down-regulating miR-93 in renal cancer cells
24281253 the inactivation of RB1 or RB2/P130 in uncommitted bone marrow stromal cells facilitates the first steps of adipogenesis.
24189068 PRMT5 knockdown in non-Hodgkin lymphoma cell lines and primary lymphoma cells leads to RBL2 derepression and RB1 reactivation, which in turn inhibit PRC2 expression.
24045973 expression profiling of miRNAs in high-grade serous ovarian carcinoma indicated miR-106a and its family members were upregulated; findings suggest miR-106a can repress expression of the retinoblastoma family member RBL2 and miR-106a overexpression results in rapid tumor growth and poor differentiation
23377830 Low expression of RBL2 is associated with glioma.
23370776 Silencing of RB1 but not RB2/P130 decreases proliferative activity and impairs the differentiation potential of human mesenchymal stem cells.
22595804 Our hypothesis not only enrich the knowledge of the regulation of ALT, but also indicate that p130 may serve as a potential suppressor of ALT, and gene therapy of p130 may be used in cervical cancers.
21813705 The results show that continued human papillomavirus 16 E6/E7 expression is necessary in cervical cancer cells to prevent cell-cycle arrest by a repressive p130-DREAM complex.
More...

AA Sequence

MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDEAARAEAWDSY      1 - 70
RSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKCSEQSLIEFFNKMKKWEDMAN     71 - 140
LPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPRQQRGRKQRRQPCTVSEIFHFCWVLFIY    141 - 210
AKGNFPMISDDLVNSYHLLLCALDLVYGNALQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLC    211 - 280
SLHDGLVLEAKGIKEHFWKPYIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDE    281 - 350
RIFLGEDAEEEIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS    351 - 420
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASK    421 - 490
HFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVP    491 - 560
LYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRVPTCEEVMPPQNLER    561 - 630
ADEICIAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPP    631 - 700
QPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQA    701 - 770
QAVTGSIQPLSAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF    771 - 840
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQ    841 - 910
NIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDRTSRDSSPVMRSSSTLPVPQP    911 - 980
SSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTFAMKYSQANMDAPPLSPYPFVRTGSPRRIQL    981 - 1050
SQNHPVYISPHKNETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPE   1051 - 1120
NHSALLRRLQDVANDRGSH                                                      1121 - 1139
//

Text Mined References (125)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26576645 2015 Hepatitis C virus core protein modulates pRb2/p130 expression in human hepatocellular carcinoma cell lines through promoter methylation.
26271034 2015 Promoter Methylation Status Modulate the Expression of Tumor Suppressor (RbL2/p130) Gene in Breast Cancer.
25183046 2014 TGF-beta induced RBL2 expression in renal cancer cells by down-regulating miR-93.
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
24281253 2014 Silencing of RB1 and RB2/P130 during adipogenesis of bone marrow stromal cells results in dysregulated differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189068 2013 Protein arginine methyltransferase 5 (PRMT5) inhibition induces lymphoma cell death through reactivation of the retinoblastoma tumor suppressor pathway and polycomb repressor complex 2 (PRC2) silencing.
24045973 2013 miR-106a represses the Rb tumor suppressor p130 to regulate cellular proliferation and differentiation in high-grade serous ovarian carcinoma.
23377830 2013 Down-regulation of miR-106b suppresses the growth of human glioma cells.
More...