Property Summary

NCBI Gene PubMed Count 117
PubMed Score 526.77
PubTator Score 279.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.200 6.4e-03
atypical teratoid / rhabdoid tumor 1.800 3.5e-05
ependymoma 1.400 1.3e-03
glioblastoma 1.300 1.3e-03
group 4 medulloblastoma 1.200 2.2e-02
intraductal papillary-mucinous adenoma (... 1.300 4.7e-03
lung cancer -1.300 6.1e-04
medulloblastoma, large-cell 1.400 1.9e-05
oligodendroglioma 1.500 1.2e-03
ovarian cancer -1.700 3.2e-08
pancreatic cancer -1.300 1.8e-02
pancreatic carcinoma -1.300 1.8e-02
psoriasis -1.400 1.9e-02
Rheumatoid arthritis 1.200 1.1e-02
Waldenstrons macroglobulinemia 1.262 1.1e-03

Protein-protein Interaction (1)

Gene RIF (72)

AA Sequence

MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDEAARAEAWDSY      1 - 70
RSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKCSEQSLIEFFNKMKKWEDMAN     71 - 140
LPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPRQQRGRKQRRQPCTVSEIFHFCWVLFIY    141 - 210
AKGNFPMISDDLVNSYHLLLCALDLVYGNALQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLC    211 - 280
SLHDGLVLEAKGIKEHFWKPYIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDE    281 - 350
RIFLGEDAEEEIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS    351 - 420
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASK    421 - 490
HFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVP    491 - 560
LYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRVPTCEEVMPPQNLER    561 - 630
ADEICIAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPP    631 - 700
QPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQA    701 - 770
QAVTGSIQPLSAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF    771 - 840
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQ    841 - 910
NIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDRTSRDSSPVMRSSSTLPVPQP    911 - 980
SSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTFAMKYSQANMDAPPLSPYPFVRTGSPRRIQL    981 - 1050
SQNHPVYISPHKNETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPE   1051 - 1120
NHSALLRRLQDVANDRGSH                                                      1121 - 1139
//

Text Mined References (127)

PMID Year Title