Property Summary

Ligand Count 230
NCBI Gene PubMed Count 80
PubMed Score 777.42
PubTator Score 654.32

Knowledge Summary

Patent (29,622)

Expression

  Differential Expression (11)

Disease log2 FC p
lung cancer -2.600 1.3e-04
adult high grade glioma 1.100 1.5e-02
Atopic dermatitis 1.200 3.8e-02
cutaneous lupus erythematosus 2.800 1.1e-03
glioblastoma 1.200 2.2e-02
interstitial cystitis 2.200 3.6e-03
invasive ductal carcinoma 1.400 4.1e-02
lung carcinoma -2.500 5.2e-20
primary Sjogren syndrome 2.100 1.4e-03
psoriasis 1.300 1.9e-40
ulcerative colitis 1.300 3.7e-03

Protein-protein Interaction (9)

Gene RIF (48)

AA Sequence

MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDI      1 - 70
SIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKYHPNFWMDGKWRCCSQLEKLA     71 - 140
TGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWR    141 - 210
VQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTK    211 - 280
AVVSENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAG    281 - 350
LRYGKWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ    351 - 420
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLV    421 - 490
GENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYE    491 - 560
NRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESGL              561 - 620
//

Text Mined References (89)

PMID Year Title