Property Summary

NCBI Gene PubMed Count 77
Grant Count 270
R01 Count 173
Funding $132,402,224.93
PubMed Score 721.19
PubTator Score 654.32

Knowledge Summary

Patent (29,622)

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 0.001
glioblastoma 1.200 0.022
Atopic dermatitis 1.200 0.038
lung cancer -2.600 0.000
interstitial cystitis 2.200 0.004
adult high grade glioma 1.100 0.015
primary Sjogren syndrome 2.100 0.001
lung carcinoma -2.500 0.000
invasive ductal carcinoma 1.400 0.041
ulcerative colitis 1.300 0.004
psoriasis 1.300 0.000

Synonym

Accession Q08881 B2R752 Q32ML7
Symbols EMT
LYK
LPFS1
PSCTK2

Gene

ITK

PDB

1SM2   1SNU   1SNX   2E6I   2LMJ   2YUQ   3MIY   3MJ1   3MJ2   3QGW   3QGY   3T9T   3V5J   3V5L   3V8T   3V8W   4HCT   4HCU   4HCV   4KIO   4L7S   4M0Y   4M0Z   4M12   4M13   4M14   4M15   4MF0   4MF1   4PP9   4PPA   4PPB   4PPC   4PQN   4QD6   4RFM  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (51)

PMID Text
25934889 We conclude that ITK, formerly considered an immune cell-specific protein, is aberrantly expressed in melanoma and promotes tumor development and progression
25593320 These data indicate that PRN694 is a highly selective and potent covalent inhibitor of ITK and RLK, and its extended target residence time enables durable attenuation of effector cells in vitro and in vivo.
25512530 approach identified 18 kinase and kinase-related genes whose overexpression can substitute for EGFR in EGFR-dependent PC9 cells, and these genes include seven of nine Src family kinase genes, FGFR1, FGFR2, ITK, NTRK1, NTRK2, MOS, MST1R, and RAF1.
25492967 The kinase Itk and the adaptor TSAd change the specificity of the kinase Lck in T cells by promoting the phosphorylation of Tyr192.
25337257 Found that 38% and 14% of the Angioimmunoblastic T-cell lymphoma cases exhibited gains of ITK and SYK genes, respectively.
25061172 ITK deficiency is a genetic cause of idiopathic CD4+ T-cell lymphopenia.
24722985 HIV-1 Nef alleles from representative M-group HIV-1 subtypes can interact with ITK. Selective ITK inhibitor blocks HIV-1 infectivity and replication in a Nef-dependent manner
24722985 HIV-1 Nef alleles from representative M-group HIV-1 subtypes can interact with ITK. Selective ITK inhibitor blocks HIV-1 infectivity and replication in a Nef-dependent manner
24462896 Data indicate reduced T-cell activation by altered IL-2 inducible T-cell kinase (ITK) expression in vitro.
24376268 T-cell-specific human ITK-Syk oncogene in mice leads to early polyclonal T cell lymphoproliferation with B cell expansion. It induces terminal T cell differentiation via Blimp-1, eliminating oncogene-expressing cells early in development.
More...

AA Sequence

MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDI      1 - 70
SIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKYHPNFWMDGKWRCCSQLEKLA     71 - 140
TGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWR    141 - 210
VQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTK    211 - 280
AVVSENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAG    281 - 350
LRYGKWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ    351 - 420
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLV    421 - 490
GENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYE    491 - 560
NRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESGL              561 - 620
//

Text Mined References (86)

PMID Year Title
25934889 2015 IL2 Inducible T-cell Kinase, a Novel Therapeutic Target in Melanoma.
25593320 2015 Targeting interleukin-2-inducible T-cell kinase (ITK) and resting lymphocyte kinase (RLK) using a novel covalent inhibitor PRN694.
25512530 2014 Genetic modifiers of EGFR dependence in non-small cell lung cancer.
25492967 2014 The kinase Itk and the adaptor TSAd change the specificity of the kinase Lck in T cells by promoting the phosphorylation of Tyr192.
25337257 2014 Angioimmunoblastic T-cell lymphoma in Taiwan shows a frequent gain of ITK gene.
25061172 2014 Identification of ITK deficiency as a novel genetic cause of idiopathic CD4+ T-cell lymphopenia.
24462896 2014 Inhibition of IL-2 inducible T-cell kinase alleviates T-cell activation and murine myocardial inflammation associated with CVB3 infection.
24376268 2014 Premature terminal differentiation protects from deregulated lymphocyte activation by ITK-Syk.
24076779 2013 ITK/SYK translocation in angioimmunoblastic T-cell lymphoma.
23454662 2013 The zinc-binding region of IL-2 inducible T cell kinase (Itk) is required for interaction with G?13 and activation of serum response factor.
More...