Property Summary

NCBI Gene PubMed Count 21
Grant Count 6
R01 Count 6
Funding $883,742.5
PubMed Score 25.32
PubTator Score 17.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
24084006 Here, the application of small ubiquitin-related modifier (SUMO) fusion technology in combination with four different chaperone teams on the soluble expression of recombinant HPS protein was explored and analyzed.
23792031 Hepassocin plays an important role in non-alcoholic fatty liver disease and induces hepatic lipid accumulation through an ERK1/2-dependent pathway.
21618590 Findings suggest that hepassocin promotes hepatic cell line L02 cells proliferation via an autocrine mechanism and inhibits HCC cells proliferation by an intracrine pathway.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19817957 Observational study of gene-disease association. (HuGE Navigator)
19304666 HNF1 binding site and HNF1alpha are critical to liver-specific expression of HPS, and down-regulation or loss of HNF1alpha causes, at least in part, the transcriptional down-regulation of HPS in HCC.
18039467 The enhancement of FGL1 levels in vitro by IL-6 and its induction after turpentine oil injection suggest that it is an acute phase reactant.
More...

AA Sequence

MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENT      1 - 70
VIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDY     71 - 140
ENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGT    141 - 210
AGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTD    211 - 280
NGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI                                          281 - 312
//

Text Mined References (24)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24084006 2013 Functional expression of hepassocin in Escherichia coli using SUMO fusion partner and molecular chaperones.
23792031 2013 The role of hepassocin in the development of non-alcoholic fatty liver disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21618590 2011 Hepassocin regulates cell proliferation of the human hepatic cells L02 and hepatocarcinoma cells through different mechanisms.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
More...