Property Summary

NCBI Gene PubMed Count 36
Grant Count 14
R01 Count 10
Funding $766,044.81
PubMed Score 42.20
PubTator Score 232.36

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (24)

PMID Text
25613138 The gene expression of adenylate cyclase 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC cells
25591908 STC1 interferes with CALCRL signaling during osteoblastogenesis via adenylate cyclase inhibition.
25568126 Increased expression of AC1 in the forebrain leads to deficits in behavioral inhibition.
25462816 AC1 catalytic activity can be adjusted by mediating calmodulin activation of AC1 by reversible methionine oxidation in calmodulin.
24482543 Results demonstrate that ADCY1 has an evolutionarily conserved role in hearing.
23504261 AGS3 reduced D(2L)DR-mediated sensitization of AC1 and AC2.
20554763 Compartmentalized AC1-CFTR association is responsible for Ca(2+)/cAMP cross-talk.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19726641 Young transgenic mice overexpressing AC1 in the forebrain (AC1+ mice) have enhanced hippocampal long-term potentiation, superior memory for novel object recognition and more persistent remote contextual memory.
19460752 Knockdown of adenylate cyclase 1 (ADCY1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
More...

AA Sequence

MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAATLKALAVLSL      1 - 70
LAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQQVGQLALLFSLTFALLCCPF     71 - 140
ALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTATLVPAKRPRL    141 - 210
WRTLGANALLFVGVNMYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMK    211 - 280
EDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKIL    281 - 350
GDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS    351 - 420
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSHRRKIFPGLIL    421 - 490
SDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTT    491 - 560
PGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKYHQLQDEYFTSAVVLTLILAALFGLVYLLI    561 - 630
FPQSVVVLLLLVFCICFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWS    631 - 700
SKPNSSLVVLSSGGQRTALPTLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELS    701 - 770
GYTRTGGGAVSGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL    771 - 840
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEK    841 - 910
DFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGIN    911 - 980
VGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKGKGEML    981 - 1050
TYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA    1051 - 1119
//

Text Mined References (36)

PMID Year Title
25591908 2015 STC1 interference on calcitonin family of receptors signaling during osteoblastogenesis via adenylate cyclase inhibition.
25568126 2015 Overexpression of the type 1 adenylyl cyclase in the forebrain leads to deficits of behavioral inhibition.
25462816 2015 Membranous adenylyl cyclase 1 activation is regulated by oxidation of N- and C-terminal methionine residues in calmodulin.
24482543 2014 Adenylate cyclase 1 (ADCY1) mutations cause recessive hearing impairment in humans and defects in hair cell function and hearing in zebrafish.
23504261 2013 Differential effects of AGS3 expression on D(2L) dopamine receptor-mediated adenylyl cyclase signaling.
20554763 2010 CFTR-adenylyl cyclase I association responsible for UTP activation of CFTR in well-differentiated primary human bronchial cell cultures.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19726641 2009 Overexpression of type I adenylyl cyclase in the forebrain impairs spatial memory in aged but not young mice.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
More...