Property Summary

Ligand Count 45
NCBI Gene PubMed Count 38
PubMed Score 45.25
PubTator Score 232.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (20)

Disease log2 FC p
lung cancer 1.300 1.8e-02
adult high grade glioma -3.200 5.9e-06
astrocytic glioma -2.700 4.9e-03
Astrocytoma, Pilocytic -2.600 3.8e-06
atypical teratoid / rhabdoid tumor -4.100 1.1e-10
ependymoma -3.500 1.1e-03
glioblastoma -2.600 2.6e-08
intraductal papillary-mucinous adenoma (... -1.900 6.4e-05
intraductal papillary-mucinous carcinoma... -2.100 3.9e-05
intraductal papillary-mucinous neoplasm ... -1.700 1.9e-03
lung carcinoma 1.700 1.2e-27
medulloblastoma -1.200 1.4e-02
medulloblastoma, large-cell -1.900 1.2e-05
oligodendroglioma -2.300 2.6e-02
osteosarcoma 1.485 1.2e-06
ovarian cancer 1.100 1.0e-07
pancreatic cancer -1.100 1.8e-05
pituitary cancer 1.900 1.8e-04
primitive neuroectodermal tumor -2.500 9.0e-04
subependymal giant cell astrocytoma -4.375 2.2e-03

Gene RIF (26)

AA Sequence

MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAATLKALAVLSL      1 - 70
LAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQQVGQLALLFSLTFALLCCPF     71 - 140
ALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTATLVPAKRPRL    141 - 210
WRTLGANALLFVGVNMYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMK    211 - 280
EDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKIL    281 - 350
GDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS    351 - 420
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSHRRKIFPGLIL    421 - 490
SDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTT    491 - 560
PGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKYHQLQDEYFTSAVVLTLILAALFGLVYLLI    561 - 630
FPQSVVVLLLLVFCICFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWS    631 - 700
SKPNSSLVVLSSGGQRTALPTLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELS    701 - 770
GYTRTGGGAVSGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL    771 - 840
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEK    841 - 910
DFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGIN    911 - 980
VGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKGKGEML    981 - 1050
TYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA    1051 - 1119
//

Text Mined References (38)

PMID Year Title