Property Summary

NCBI Gene PubMed Count 54
Grant Count 147
R01 Count 84
Funding $14,202,083.1
PubMed Score 53.25
PubTator Score 105.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.500 0.039
lung cancer 2.600 0.000
aldosterone-producing adenoma -1.193 0.041
ovarian cancer 1.900 0.000

Synonym

Accession Q08752 B2R9V2 PPIase D
Symbols CYPD
CYP-40

Gene

PANTHER Protein Class (1)

Gene RIF (25)

PMID Text
26387735 Results show that CypD interacts with SPG7 and VDAC to form the mitochondrial permeability transition pore complex (PTP)and its CsA-binding region is necessary for PTP formation.
26330616 The thermodynamics of binding of Cyp-40 to Hsp90 shows remarkable temperature sensitivity in the physiological temperature range.
25966197 cyclophilin-D protein could increase oxidative stress and cause endothelial cell injury and apoptosis. cyclophilin-D protein is the key factor in reactive oxygen species-induced mitochondrial damage, leading to apoptosis of endothelial cells.
25837584 Cyp-D silencing down-regulated mitochondrial transcripts initiated from the heavy strand promoter 2 [i.e., NADH dehydrogenase 1 (ND1) by 11-fold; cytochrome oxidase 1 (COX1) by 4-fold; and ATP synthase subunit 6 (ATP6) by 6.5-fold.
25445707 molecular determinants necessary for Cyclophilin D activity regulation and binding to proposed pore constituents thereby regulating the mitochondrial permeability transition pore.
25058685 Cyp40 binds to C2I in vitro and in intact cells, it also interacts with the enzyme components of iota toxin and CDT, suggesting a common principle for this toxin family.
24946211 In summary, the results of the present study provide mechanistic evidence that both apoptosis and programmed necrosis attribute to berberine's cytotoxicity in prostate cancer cells.
24343341 The p53/Cyp-D mitochondrial complexation was prevented by CsA or Cyp-D silencing.
24138221 The Photorhabdus toxins TccC3 and TccC5 interacted with Hsp90, FKBP51, Cyp40 and CypA, suggesting a role of these host cell factors in translocation and/or refolding of the ADP-ribosyltransferases.
23845906 cisplatin-induced non-apoptotic death requires mitochondria Cyp-D-p53 signaling in pancreatic cancer cells
More...

AA Sequence

MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG      1 - 70
CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP     71 - 140
HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD    141 - 210
IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG    211 - 280
ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV    281 - 350
KQKIKAQKDKEKAVYAKMFA                                                      351 - 370
//

Text Mined References (61)

PMID Year Title
26387735 2015 SPG7 Is an Essential and Conserved Component of the Mitochondrial Permeability Transition Pore.
26330616 2015 Cyclophilin40 isomerase activity is regulated by a temperature-dependent allosteric interaction with Hsp90.
25966197 2015 Influence of cyclophilin D protein expression level on endothelial cell oxidative damage resistance.
25837584 2015 Cyclophilin-D: a resident regulator of mitochondrial gene expression.
25445707 2015 Structural mechanisms of cyclophilin D-dependent control of the mitochondrial permeability transition pore.
25058685 2015 Cyclophilin-facilitated membrane translocation as pharmacological target to prevent intoxication of mammalian cells by binary clostridial actin ADP-ribosylated toxins.
24946211 2014 Mitochondrial protein cyclophilin-D-mediated programmed necrosis attributes to berberine-induced cytotoxicity in cultured prostate cancer cells.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24343341 2014 The mitochondrial cyclophilin D/p53 complexation mediates doxorubicin-induced non-apoptotic death of A549 lung cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...