Property Summary

NCBI Gene PubMed Count 138
Grant Count 354
R01 Count 200
Funding $60,582,284.96
PubMed Score 506.00
PubTator Score 335.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q08722 A8K198 D3DN59 Q53Y71 Q96A60
Symbols IAP
OA3
MER6

Gene

PDB

2JJS   2JJT   2VSC   4CMM   4KJY   5IWL  

Gene RIF (108)

PMID Text
27437576 atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis'
26573233 Data suggest a reduction in the CD47 antigen/signal-regulatory protein alpha (SIRPalpha) pathway by programmed cell death protein 1 (PD-1) blockade, which regulates Myeloid-derived suppressor cells (MDSCs) and tumor associated macrophages (TAMs).
26512116 CD47 expression contributes to the lethal breast cancer phenotype that is mediated by HIF-1.
26311851 CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury
26116271 agents that block the CD47:SIRP-alpha engagement are attractive therapeutic targets as a monotherapy or in combination with additional immune-modulating agents for activating antitumor T cells in vivo
26093091 CD47 is a critical regulator in the metastasis of osteosarcoma and results suggest that targeted inhibition of this antigen by anti-CD47 may be a novel immunotherapeutic approach in the management of this tumor.
26085683 Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages.
26077800 CD47 is an adverse prognostic factor and promising therapeutic target in gastric cancer.
25943033 While CD47 expression on circulating AML blasts has been shown to be a negative prognostic marker for a very defined population of AML patients with NK AML, CD47 expression on AML BM blasts is not
25896326 during translation of CD47, the scaffold function of the 3' UTR facilitates binding of proteins to nascent proteins, to direct their transport or function--and this role of 3' UTRs can be regulated by polyadenylation
More...

AA Sequence

MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDG      1 - 70
ALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPN     71 - 140
ENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPGEYSLKNATGL    141 - 210
GLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILAL    211 - 280
AQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE                               281 - 323
//

Text Mined References (141)

PMID Year Title
27437576 2016 CD47-blocking antibodies restore phagocytosis and prevent atherosclerosis.
26573233 2015 PD-1 blockade attenuates immunosuppressive myeloid cells due to inhibition of CD47/SIRP? axis in HPV negative head and neck squamous cell carcinoma.
26512116 2015 HIF-1 regulates CD47 expression in breast cancer cells to promote evasion of phagocytosis and maintenance of cancer stem cells.
26311851 2015 CD47 Receptor Globally Regulates Metabolic Pathways That Control Resistance to Ionizing Radiation.
26116271 2015 Molecular Pathways: Activating T Cells after Cancer Cell Phagocytosis from Blockade of CD47 "Don't Eat Me" Signals.
26093091 2015 CD47 blockade inhibits tumor progression human osteosarcoma in xenograft models.
26085683 2015 Loss of Cell Surface CD47 Clustering Formation and Binding Avidity to SIRP? Facilitate Apoptotic Cell Clearance by Macrophages.
26077800 2015 CD47 is an adverse prognostic factor and a therapeutic target in gastric cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25943033 2015 CD47 protein expression in acute myeloid leukemia: A tissue microarray-based analysis.
More...