Property Summary

NCBI Gene PubMed Count 153
PubMed Score 566.30
PubTator Score 335.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (34)

Disease log2 FC p
adult high grade glioma -1.500 2.3e-04
astrocytic glioma -1.400 3.8e-02
Atopic dermatitis 1.200 2.0e-03
atypical teratoid / rhabdoid tumor -1.100 1.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.109 7.9e-03
Breast cancer -1.700 9.1e-12
cystic fibrosis 1.401 8.1e-06
dermatomyositis 1.200 2.6e-02
Duchenne muscular dystrophy 1.425 6.8e-06
ependymoma -2.000 3.5e-02
glioblastoma 2.500 2.9e-04
group 3 medulloblastoma -1.700 3.5e-04
intraductal papillary-mucinous adenoma (... 1.400 8.8e-03
intraductal papillary-mucinous carcinoma... 1.300 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.900 1.2e-02
invasive ductal carcinoma -1.100 1.7e-02
juvenile dermatomyositis 1.614 2.5e-09
lung adenocarcinoma -1.200 4.7e-06
lung cancer -1.300 2.0e-03
malignant mesothelioma -1.700 2.8e-07
medulloblastoma, large-cell -2.200 2.5e-04
Multiple myeloma 2.760 8.8e-06
non-small cell lung cancer -1.764 3.0e-19
oligodendroglioma -1.300 4.5e-02
osteosarcoma -1.626 1.3e-04
ovarian cancer -1.200 2.2e-03
pancreatic cancer 1.200 1.8e-04
pancreatic ductal adenocarcinoma liver m... 1.724 1.5e-02
Pick disease -1.200 9.8e-03
primary Sjogren syndrome 1.300 3.2e-03
primitive neuroectodermal tumor -1.300 5.2e-06
psoriasis 1.700 1.2e-11
ulcerative colitis 1.100 2.2e-07
Waldenstrons macroglobulinemia 1.377 1.6e-02

Protein-protein Interaction (2)

Gene RIF (124)

AA Sequence

MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDG      1 - 70
ALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPN     71 - 140
ENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPGEYSLKNATGL    141 - 210
GLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILAL    211 - 280
AQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE                               281 - 323
//

Text Mined References (156)

PMID Year Title