Property Summary

NCBI Gene PubMed Count 16
PubMed Score 175.70
PubTator Score 57.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 1.0

Expression

Gene RIF (7)

AA Sequence

MTARAWASWRSSALLLLLVPGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVE      1 - 70
TKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTAS     71 - 140
SPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQR    141 - 210
SSRSRQNWPKGENQ                                                            211 - 224
//

Text Mined References (17)

PMID Year Title