Property Summary

NCBI Gene PubMed Count 15
Grant Count 53
R01 Count 18
Funding $64,040,569.29
PubMed Score 159.50
PubTator Score 57.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Disease of anatomical entity 25 1.0

Expression

Gene RIF (6)

PMID Text
23571507 potential role in inflammatory responses
23372157 engagement of CD300C led to Fc receptor gamma-dependent activation of mast cells and monocytes
22046970 differential expression on human TH1 and TH17 cell memory subsets
20656921 CD300a and CD300c receptors are indistinguishable on the surface of natural killer (NK) cells. The tyrosine residue in the third ITIM motif, Tyr-267-Ala, is the most important residue for execution of the inhibitory signal.
18535206 CD300a and CD300c play an important role in the cross-regulation of TNF-alpha and IFN-alpha secretion from pDCs; CD300a/c RNA and surface expression were downregulated after stimulation of pDCs with TLR7 and TLR9 ligands
12456026 CMRF35A and CMRF35H have roles in immunoglobulin signaling; CMRF35A induces cellular activation and effector function [review]

AA Sequence

MTARAWASWRSSALLLLLVPGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVE      1 - 70
TKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTAS     71 - 140
SPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQR    141 - 210
SSRSRQNWPKGENQ                                                            211 - 224
//

Text Mined References (16)

PMID Year Title
23571507 2013 CD300c is an activating receptor expressed on human monocytes.
23372157 2013 Human CD300C delivers an Fc receptor-?-dependent activating signal in mast cells and monocytes and differs from CD300A in ligand recognition.
22046970 2011 Differential expression of CD300a/c on human TH1 and TH17 cells.
20656921 2010 Expression and function of CD300 in NK cells.
19592130 2009 The CD300 molecules regulate monocyte and dendritic cell functions.
19359216 2009 The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.
18535206 2008 CD300a/c regulate type I interferon and TNF-alpha secretion by human plasmacytoid dendritic cells stimulated with TLR7 and TLR9 ligands.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12483297 2003 Novel immunoglobulin superfamily gene cluster, mapping to a region of human chromosome 17q25, linked to psoriasis susceptibility.
More...