Property Summary

NCBI Gene PubMed Count 14
Grant Count 19
R01 Count 9
Funding $1,932,211.25
PubMed Score 10.37
PubTator Score 15.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (9)

PMID Text
25573789 we report the three dimensional structure of the human SPAG11B proteins and their C-terminal peptides. web-based hydropathy, amphipathicity, and topology (WHAT) analyses and grand average of hydropathy
21933954 Combination of two proteins, SPAG11B and TEX101, can be used for differential diagnosis of azoospermia
19535787 SPAG11B/D is both a substrate and a potent inhibitor of TPSAB1 activity.
16411022 Isoform C of SPAG11B encodes a peptide with antimicrobial activity against E. coli.
15229135 EP2 expression is more widespread in male reproductive tract than realized previously. Activity of every EP2 variant tested is antibacterial. Further investigation may reveal additional roles for EP2 peptides in primate male reproductive tract.
14662784 HE2 transcriptional and translational products normally expressed in the caput epididymidis were not affected by vasectomy.
12193388 HE2 peptides were detected in human epididymal epithelium, epididymal fluid, and ejaculate
11259252 The human HE2/EP2 gene is the fusion product of two ancestral beta-defensin genes. During its evolution, the gene has acquired additional exons whose inclusion produces new message variants that encode peptides unrelated to defensins.
10819450 In the chimpanzee epididymis, several mRNA HE2/EP2 variants are produced. Of these, three cDNAs code for two different protein sequences that have a cysteine distribution characteristic for beta-defensins.

AA Sequence

MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPY      1 - 70
QVHISHREARGPSFRICVDFLGPRWARGCSTGN                                          71 - 103
//

Text Mined References (15)

PMID Year Title
25573789 2015 Molecular modeling of the human sperm associated antigen 11 B (SPAG11B) proteins.
21933954 2011 Verification of male infertility biomarkers in seminal plasma by multiplex selected reaction monitoring assay.
19535787 2009 Novel partners of SPAG11B isoform D in the human male reproductive tract.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16411022 2006 Antimicrobial actions of human and macaque sperm associated antigen (SPAG) 11 isoforms: influence of the N-terminal peptide.
15229135 2004 Differential expression and antibacterial activity of epididymis protein 2 isoforms in the male reproductive tract of human and rhesus monkey (Macaca mulatta).
14662784 Vasectomy influences expression of HE1 but not HE2 and HE5 genes in human epididymis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193388 2002 Novel antimicrobial peptide of human epididymal duct origin.
11259252 2001 Organization of the human gene encoding the epididymis-specific EP2 protein variants and its relationship to defensin genes.
More...