Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.93
PubTator Score 15.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (9)

AA Sequence

MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPY      1 - 70
QVHISHREARGPSFRICVDFLGPRWARGCSTGN                                          71 - 103
//

Text Mined References (15)

PMID Year Title