Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
R01 Count 1
Funding $227,141
PubMed Score 93.74
PubTator Score 33.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q08629 B3KSW3 Q59EW0 Q8N630 Q9UCL8
Symbols TIC1
SPOCK
TESTICAN

Gene

 Grant Application (1)

Gene RIF (11)

PMID Text
26638890 SPOCK1 is highly expressed in ovarian cancer.SPOCK1 contributes to ovarian cancer development and metastasis.
26138584 Collectively, altered expression of PKP1 and SPOCK1 appears to be a frequent and critical event in prostate cancer
26077618 These results suggest that up-regulation of SPOCK1 in ESCC induces EMT, thus promotes migration and invasion in ESCC cells.
25623055 SPOCK1 activates PI3K/Akt signaling.
24134845 this study showed that SPOCK1 is a novel metastasis related biomarker in lung cancer and may be new diagnostic and therapeutic target for lung cancer.
23873022 Testican-1-induced EMT signaling.
23022495 In the present study, we showed that SPOCK1 could inhibit apoptosis and promote cancer invasion.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19282985 SPOCK gene underlies variation of age at menarche
19282985 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRFRDDDYFRNWN      1 - 70
PNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCP     71 - 140
VAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRL    141 - 210
KDWFGALHEDANRVIKPTSSNTAQGRFDTSILPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPC    211 - 280
IKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHG    281 - 350
STGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAV    351 - 420
TEDDEDEDDDKEDEVGYIW                                                       421 - 439
//

Text Mined References (30)

PMID Year Title
26638890 2015 Effects of shRNA-mediated knockdown of SPOCK1 on ovarian cancer growth and metastasis.
26138584 2015 Plakophilin 1-deficient cells upregulate SPOCK1: implications for prostate cancer progression.
26077618 2015 Up-regulation of SPOCK1 induces epithelial-mesenchymal transition and promotes migration and invasion in esophageal squamous cell carcinoma.
25623055 2015 SPOCK1 as a potential cancer prognostic marker promotes the proliferation and metastasis of gallbladder cancer cells by activating the PI3K/AKT pathway.
24134845 2013 SPOCK1 is a novel transforming growth factor-? target gene that regulates lung cancer cell epithelial-mesenchymal transition.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23873022 2014 Testican-1-mediated epithelial-mesenchymal transition signaling confers acquired resistance to lapatinib in HER2-positive gastric cancer.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23022495 2013 SPOCK1 is regulated by CHD1L and blocks apoptosis and promotes HCC cell invasiveness and metastasis in mice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...