Property Summary

NCBI Gene PubMed Count 176
Grant Count 104
R01 Count 48
Funding $7,576,191.19
PubMed Score 166.99
PubTator Score 230.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Acrodysostosis 9 6.201 3.1
Cerebrovascular disease 231 4.947 2.5
Brachydactyly 52 4.217 2.1
Asthma 349 3.599 1.8
Pseudohypoparathyroidism 17 3.597 1.8
Chronic obstructive pulmonary disease 146 3.392 1.7
ACRDYS2 1
Amphetamine-Related Disorders 74
Aphthous ulcer of mouth 7
Atopic dermatitis 944
Breast cancer 3,094 2.0
CHROMOSOME 5q12 DELETION SYNDROME 1
COPD Associated with Chronic Bronchitis 11
Cerebrovascular accident 44
Cognitive disorder 44 1.0
Crohn's disease 304
Dysuria 24
Esophageal cancer 21 2.0
Increased Urinary Frequency 11
Malignant neoplasm of breast 63
Malignant neoplasm of esophagus 18
Nocturia 8
Plaque psoriasis 14
Prostatic Neoplasms 471
Psoriasis with arthropathy 11
Severe chronic obstructive pulmonary dis... 4 
Squamous cell carcinoma of esophagus 82
Suprapubic pain 8
Urgent desire to urinate 11
Urinary Tract Irritation 24
Urinary incontinence 13
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
colon cancer 1,475
glioblastoma 5,572
hepatocellular carcinoma 532
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
medulloblastoma, large-cell 6,234
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
pancreatic cancer 2,300
pancreatic carcinoma 567
pilocytic astrocytoma 3,086
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession Q08499 O43433 Q13549 Q13550 Q13551 Q7Z2L8 Q8IV84 Q8IVA9 Q8IVD2 Q8IVD3 Q96HL4 Q9HCX7
Symbols DPDE3
PDE43
STRK1
ACRDYS2
HSPDE4D
PDE4DN2

Gene

PANTHER Protein Class (2)

PDB

1E9K   1MKD   1OYN   1PTW   1Q9M   1TB7   1TBB   1XOM   1XON   1XOQ   1XOR   1Y2B   1Y2C   1Y2D   1Y2E   1Y2K   1ZKN   2FM0   2FM5   2PW3   2QYN   3G4G   3G4I   3G4K   3G4L   3G58   3IAD   3IAK   3K4S   3SL3   3SL4   3SL5   3SL6   3SL8   3V9B   4OGB   4W1O   4WCU  

Gene RIF (148)

PMID Text
26782593 While prior studies have found an association between PDE4D and IL6R polymorphisms and ischemic stroke, the results of this study suggest that this association may be different in a hypertensive population.
26671126 This review show PDE4D mutation is a risk factor for atrial fibrillation and stroke.
26575822 Data highlight an increase in PDE4D7 expression during initial tumorigenesis and further support the findings that PDE4D7 levels fall profoundly in castration resistant prostate cancer, suggesting it as a potential biomarker and therapeutic target.
26371509 PDE4D interacts directly with Neuropilins, positive regulators of Hedgehog signal transduction pathway.
26345966 The increase in the C allele frequency at 87 single nucleotide polymorphism sites in PDE4D may increase ischemic stroke risk.
26211680 In this article, we review the role of the cAMP signal transduction pathway in memory formation with a particular focus on the recent progress in PDE4D research
26181301 Aberrant DNA methylation of PDE4D promoter alters airway smooth muscle cell phenotypes.
25775568 structural analysis of the autoinhibited conformation of PDE4
25680530 PKA phosphorylation of the PDE4D7 N-terminus appears to occur constitutively and inhibits PDE4 activity to allow cAMP signalling under basal conditions.
25546709 Critical residues stabilising PDE4D5 dimerization were defined within the regulatory UCR1 region found in long, but not short, PDE4 isoforms, namely the Arg(173), Asn(174) and Asn(175) (DD1) cluster.
More...

AA Sequence

MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPPPPPSPQPQPQ      1 - 70
CPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRAMDRTSYAVETGHRPGLKKSR     71 - 140
MSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNS    141 - 210
SIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASET    211 - 280
LEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPT    281 - 350
QKEKEKKKRPMSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL    351 - 420
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDL    421 - 490
EILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQ    491 - 560
SLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQL    561 - 630
YRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDT    631 - 700
LEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCT    701 - 770
QDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT                                   771 - 809
//

Text Mined References (189)

PMID Year Title
26782593 2015 Association of phosphodiesterase 4D gene and interleukin-6 receptor gene polymorphisms with ischemic stroke in a Chinese hypertensive population.
26671126 2015 Phosphodiesterase4D (PDE4D)--A risk factor for atrial fibrillation and stroke?
26575822 2015 Human phosphodiesterase 4D7 (PDE4D7) expression is increased in TMPRSS2-ERG-positive primary prostate cancer and independently adds to a reduced risk of post-surgical disease progression.
26371509 2015 Phosphodiesterase 4D acts downstream of Neuropilin to control Hedgehog signal transduction and the growth of medulloblastoma.
26345966 2015  Investigation of single nucleotide polymorphisms in phosphodiesterase 4D gene in Mongol and Han patients with ischemic stroke in Inner Mongolia.
26211680 2015 Phosphodiesterase 4D: an enzyme to remember.
26181301 2016 Aberrant DNA Methylation of Phosphodiesterase [corrected] 4D Alters Airway Smooth Muscle Cell Phenotypes.
25775568 2015 Engineered stabilization and structural analysis of the autoinhibited conformation of PDE4.
25680530 2015 The activity of cAMP-phosphodiesterase 4D7 (PDE4D7) is regulated by protein kinase A-dependent phosphorylation within its unique N-terminus.
25546709 2015 Dimerization of cAMP phosphodiesterase-4 (PDE4) in living cells requires interfaces located in both the UCR1 and catalytic unit domains.
More...