Property Summary

NCBI Gene PubMed Count 26
PubMed Score 56.58
PubTator Score 29.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 3.3e-04
astrocytic glioma -1.400 8.9e-03
Astrocytoma, Pilocytic -2.300 2.2e-08
atypical teratoid / rhabdoid tumor -1.900 5.0e-10
ependymoma -1.300 1.1e-02
glioblastoma -1.800 7.9e-09
group 3 medulloblastoma -2.700 2.9e-05
medulloblastoma, large-cell -1.500 4.4e-05
mucosa-associated lymphoid tissue lympho... 1.883 1.8e-02
oligodendroglioma -1.800 3.8e-20
osteosarcoma -3.712 9.5e-05
primitive neuroectodermal tumor -1.400 2.7e-03

Gene RIF (8)

AA Sequence

MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTY      1 - 70
SLLEHVELPRSRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGTPRTSLPHFHHPETSRPDSNI     71 - 140
YKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKA    141 - 210
SRRGAEEEEEEEDDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSL    211 - 280
HQGTSKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVV    281 - 350
TNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF                   351 - 405
//

Text Mined References (34)

PMID Year Title