Property Summary

NCBI Gene PubMed Count 26
Grant Count 33
R01 Count 31
Funding $3,830,789.42
PubMed Score 54.85
PubTator Score 29.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.700 0.004
ependymoma -1.700 0.000
glioblastoma -2.200 0.000
oligodendroglioma -1.800 0.000
osteosarcoma -3.712 0.000
group 3 medulloblastoma -2.700 0.000
atypical teratoid/rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.400 0.003
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -2.300 0.000
mucosa-associated lymphoid tissue lympho... 1.883 0.018

Gene RIF (8)

PMID Text
23355471 When unphosphorylated, dematin's two F-actin binding domains move independent of one another permitting them to bind different F-actin filaments.
23060452 the headpiece domain of dematin regulates calcium mobilization and signaling in platelets
22927433 a novel functional role for dematin in regulating erythrocyte membrane function.
20396930 Fast backbone dynamics probed at amide nitrogen versus carbonyl carbon sites for dematin headpiece C-terminal. The reduction of mobility in the loop region upon the S74E mutation can be seen from the (15)N order parameters.
19241372 results suggest that the core domain of dematin exhibits properties typical of a natively unfolded protein, while the headpiece domain is folded in a conformation essentially identical to its native structure
19030997 study investigated motions in the backbone of dematin headpiece domain and its mutant DHPS74E using several complementary NMR relaxation techniques
16697408 a crucial role for this proline residue in structural stability and folding potential of HP (sub)domains consistent with Pro-Trp stacking as a more general determinant of protein stability
14660664 results suggest that phosphorylation of the dematin headpiece acts as a conformational switch within this headpiece domain

AA Sequence

MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTY      1 - 70
SLLEHVELPRSRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGTPRTSLPHFHHPETSRPDSNI     71 - 140
YKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKA    141 - 210
SRRGAEEEEEEEDDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSL    211 - 280
HQGTSKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVV    281 - 350
TNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF                   351 - 405
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23973789 2013 Dematin, a human erythrocyte cytoskeletal protein, is a substrate for a recombinant FIKK kinase from Plasmodium falciparum.
23355471 2013 The allosteric mechanism induced by protein kinase A (PKA) phosphorylation of dematin (band 4.9).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23060452 2012 Headpiece domain of dematin regulates calcium mobilization and signaling in platelets.
22927433 2012 Identification of a novel role for dematin in regulating red cell membrane function by modulating spectrin-actin interaction.
22456662 2012 Proteomic analysis shows the upregulation of erythrocyte dematin in zinc-restricted human subjects.
21084299 2011 Dematin, a component of the erythrocyte membrane skeleton, is internalized by the malaria parasite and associates with Plasmodium 14-3-3.
20396930 2010 Comparison of fast backbone dynamics at amide nitrogen and carbonyl sites in dematin headpiece C-terminal domain and its S74E mutant.
More...