Property Summary

Ligand Count 79
NCBI Gene PubMed Count 23
PubMed Score 11.30
PubTator Score 16.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 2.000 8.5e-03
Astrocytoma, Pilocytic -1.700 2.8e-04
atypical teratoid / rhabdoid tumor -2.100 1.0e-06
ependymoma 2.200 7.5e-03
esophageal adenocarcinoma 1.300 1.8e-02
glioblastoma -1.200 1.5e-03
group 3 medulloblastoma -2.000 2.6e-02
intraductal papillary-mucinous carcinoma... 1.200 1.2e-02
medulloblastoma, large-cell -1.800 1.5e-02
Multiple myeloma -1.555 8.4e-03
oligodendroglioma 2.100 4.3e-03
osteosarcoma 1.616 5.0e-06
ovarian cancer -1.400 1.0e-03
pancreatic ductal adenocarcinoma liver m... 2.550 2.2e-03
pediatric high grade glioma -1.700 3.7e-04
Pick disease 1.100 1.2e-07
primitive neuroectodermal tumor -2.000 9.6e-04
psoriasis 1.700 4.6e-05

Gene RIF (7)

AA Sequence

MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKS      1 - 70
RLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESFLYRSDSDYELSPKAMSRNSS     71 - 140
VASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGAAKQGPVGNPSSSNQLPPAEDTGQKLALETL    141 - 210
DELDWCLDQLETLQTRHSVGEMASNKFKRILNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTA    211 - 280
EEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAII    281 - 350
FSIFQERDLLKTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA    351 - 420
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNLSAKQRLSLRR    421 - 490
MVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQW    491 - 560
TDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDN    561 - 630
REWYQSKIPRSPSDLTNPERDGPDRFQFELTLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGP    631 - 700
DPGDLPLDNQRT                                                              701 - 712
//

Text Mined References (23)

PMID Year Title