Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 4
Funding $164,561.65
PubMed Score 10.71
PubTator Score 16.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma -1.555 0.008
astrocytic glioma 2.000 0.009
ependymoma 2.200 0.008
oligodendroglioma 2.100 0.004
esophageal adenocarcinoma 1.300 0.018
psoriasis 1.700 0.000
osteosarcoma 2.602 0.000
glioblastoma -2.100 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -1.800 0.015
primitive neuroectodermal tumor -2.000 0.001
pancreatic ductal adenocarcinoma liver m... 2.550 0.002
intraductal papillary-mucinous carcinoma... 1.200 0.012
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.700 0.000
Pick disease 1.100 0.000
ovarian cancer -1.400 0.001

Synonym

Accession Q08493 B3KTC4 Q9UN44 Q9UN45 Q9UN46 Q9UPJ6
Symbols DPDE1
PDE21

Gene

PANTHER Protein Class (2)

PDB

1LXU   2QYM  

Gene RIF (7)

PMID Text
24842301 Data show that PDE4C is downregulated through promoter hypermethylation in glioma.
24732776 Cyclic AMP phosphodiesterase inhibitors AV411 and AV1013 inhibit HIV-1 replication and block HIV-1 Tat-induced neurotoxicity in human microglia, suggesting that cyclic AMP phosphodiesterase is involved in the Tat-mediated neurotoxicity
23043089 PDE4A and PDE4C work in redundant fashion to mediate the loss of inhibitory PGE2 signaling in lung fibroblasts.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
11156964 Cyclic AMP phosphodiesterase inhibitors AV411 and AV1013 inhibit HIV-1 replication and block HIV-1 Tat-induced neurotoxicity in human microglia, suggesting that cyclic AMP phosphodiesterase is involved in the Tat-mediated neurotoxicity

AA Sequence

MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKS      1 - 70
RLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESFLYRSDSDYELSPKAMSRNSS     71 - 140
VASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGAAKQGPVGNPSSSNQLPPAEDTGQKLALETL    141 - 210
DELDWCLDQLETLQTRHSVGEMASNKFKRILNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTA    211 - 280
EEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAII    281 - 350
FSIFQERDLLKTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA    351 - 420
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNLSAKQRLSLRR    421 - 490
MVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQW    491 - 560
TDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDN    561 - 630
REWYQSKIPRSPSDLTNPERDGPDRFQFELTLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGP    631 - 700
DPGDLPLDNQRT                                                              701 - 712
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24842301 2014 Integrated analysis using methylation and gene expression microarrays reveals PDE4C as a prognostic biomarker in human glioma.
23043089 2012 Attenuation of inhibitory prostaglandin E2 signaling in human lung fibroblasts is mediated by phosphodiesterase 4.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17727341 2007 Structures of the four subfamilies of phosphodiesterase-4 provide insight into the selectivity of their inhibitors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
More...