Property Summary

NCBI Gene PubMed Count 23
Grant Count 67
R01 Count 45
Funding $8,226,341.93
PubMed Score 47.35
PubTator Score 4812.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q08477 B7Z8Z3 O60634 Q5U740
Symbols CPF3
CYP4F
LTB4H

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
24406470 Children who consumed a higher dietary ratio of omega6/omega3 were susceptible for Crohn's disease if they were also carriers of specific variants of CYP4F3 and FADS2 genes.
22706230 In this short review, emphasis will be placed on the regulation and the functional roles of human CYP4F3--{REVIEW}
20237496 Observational study of gene-disease association. (HuGE Navigator)
20047521 can directly stimulate osteoclast differentiation dependent of RANKL
19343046 Observational study of gene-disease association. (HuGE Navigator)
19138970 By regulating the balance of LTB4 in the lung, LTB4OH may function as a suppressor of lung carcinogenesis.
18577768 Main fatty acid pathway is the omega-hydroxylation of polyunsaturated fatty acids.
18566475 CYP4F3B is the key enzyme to produce 20-HETE by omega-hydroxylation of arachidonic acid in liver cells
18065749 3-hydroxystearate and 3-hydroxypalmitate are converted to omega-hydroxylated 3-OHDCA precursors in liver; CYP4F11 and, to a lesser extent, CYP4F2 catalyzed omega-hydroxylation of 3-hydroxystearate; CYP4F3b, CYP4F12, and CYP4A11 had negligible activity.
17980168 Results decribe the expression and physiological function of CYP4F3A and its subfamily in human eosinophils.
More...

AA Sequence

MPQLSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSS      1 - 70
EEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSA     71 - 140
GEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSF    141 - 210
DSHCQEKPSEYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPS    211 - 280
QGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY    281 - 350
QERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIIC    351 - 420
LISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFR    421 - 490
VLPDHTEPRRKPELVLRAEGGLWLRVEPLS                                            491 - 520
//

Text Mined References (27)

PMID Year Title
24406470 2014 Interactions between the dietary polyunsaturated fatty acid ratio and genetic factors determine susceptibility to pediatric Crohn's disease.
22706230 2012 Human cytochrome P450 4F3: structure, functions, and prospects.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20047521 2010 LTB4 can stimulate human osteoclast differentiation dependent of RANKL.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19138970 2008 Differential modulation of leukotriene B4 synthesis and degradation in human bronchoalveolar lavage cells by lipopolysaccharide and tobacco smoke.
18577768 2008 Cytochromes P450 from family 4 are the main omega hydroxylating enzymes in humans: CYP4F3B is the prominent player in PUFA metabolism.
18566475 2008 CYP4F3B is induced by PGA1 in human liver cells: a regulation of the 20-HETE synthesis.
18065749 2008 Omega oxidation of 3-hydroxy fatty acids by the human CYP4F gene subfamily enzyme CYP4F11.
More...