Property Summary

NCBI Gene PubMed Count 24
PubMed Score 50.67
PubTator Score 4812.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus -1.300 1.8e-02
ependymoma 1.500 1.7e-02
head and neck cancer -1.400 3.9e-02
head and neck cancer and chronic obstruc... -1.600 1.0e-03
interstitial cystitis -1.600 5.9e-03
intraductal papillary-mucinous neoplasm ... 4.300 5.3e-04
lung cancer 2.200 7.7e-04
medulloblastoma -1.100 2.4e-03
mucosa-associated lymphoid tissue lympho... 2.432 3.6e-02
nephrosclerosis -1.745 4.1e-02
osteosarcoma -4.890 2.6e-05
pancreatic cancer 1.300 2.2e-03
psoriasis -1.100 1.4e-03
Rheumatoid arthritis 1.700 2.8e-02
tuberculosis 1.500 4.4e-02

Gene RIF (14)

AA Sequence

MPQLSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSS      1 - 70
EEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSA     71 - 140
GEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSF    141 - 210
DSHCQEKPSEYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPS    211 - 280
QGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY    281 - 350
QERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIIC    351 - 420
LISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFR    421 - 490
VLPDHTEPRRKPELVLRAEGGLWLRVEPLS                                            491 - 520
//

Text Mined References (28)

PMID Year Title