Property Summary

NCBI Gene PubMed Count 35
Grant Count 14
R01 Count 9
Funding $930,644.27
PubMed Score 19.76
PubTator Score 130.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.200 0.004
ependymoma -2.700 0.000
oligodendroglioma -2.300 0.000
psoriasis -1.500 0.000
cutaneous lupus erythematosus -2.200 0.007
glioblastoma -4.300 0.000
medulloblastoma -4.600 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -4.300 0.001
primitive neuroectodermal tumor -4.300 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.000
interstitial cystitis -1.100 0.009
pediatric high grade glioma -3.300 0.000
pilocytic astrocytoma -3.500 0.000
lung carcinoma 3.500 0.000
ovarian cancer -1.200 0.000
chronic rhinosinusitis -1.150 0.003
facioscapulohumeral dystrophy 1.700 0.014

Gene RIF (16)

PMID Text
25815774 In patients receiving capecitabine monotherapy, rs4702484, located in ADCY2 and close to MTRR, was associated with slightly reduced PFS for homozygous wild-type patients (CC 6.2 vs. CT 8.0 months; P=0.018).
24363043 Our present study defines an AC2 cAMP signaling compartment that specifically regulates IL-6 expression in bronchial smooth muscle cells.
23889134 AKAP79, PKC, PKA and PDE4 participate in a Gq-linked muscarinic receptor and adenylate cyclase 2 cAMP signalling complex.
23504261 AGS3 reduced D(2L)DR-mediated sensitization of AC1 and AC2.
22461431 A replication of association between two SNPs previously associated with COPD (CHRNA3/5 and IREB2), as well as an association with COPD of one locus initially associated with lung function (ADCY2).
21528083 Data suggest that SPARCL1, Shp2, MSH2, E-cadherin, p53, ADCY-2 and MAPK are potential prognostic markers in colorectal cancer.
21228062 AC2 and AC4 isoforms, stimulated by GTP binding protein betagamma subunits, are expressed in bronchial nonlipid raft membrane fractions where they colocalize with and couple to prostanoid EP2 receptors.
20664520 AC2 interacts with RXFP1 through AKAP79, whereas the association with PDE4D3 and PKA depends upon beta-arrestin 2 binding to Ser704.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLALLAVFFALGL      1 - 70
EVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQVSFF     71 - 140
LFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSATPGGKEHLVWQILANVIIFICGNLAGAYHKH    141 - 210
LMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHN    211 - 280
LYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPIS    281 - 350
LPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG    351 - 420
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAKMRA    421 - 490
SVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQA    491 - 560
IDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSVLGI    561 - 630
SFGAAFLLLAFILFVCFAGQLLQCSKKASPLLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFF    631 - 700
LSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVAL    701 - 770
VGYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK    771 - 840
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGL    841 - 910
ECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGTMVEFAFAL    911 - 980
VGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVL    981 - 1050
QTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS                                1051 - 1091
//

Text Mined References (38)

PMID Year Title
25815774 2015 Clinical validation study of genetic markers for capecitabine efficacy in metastatic colorectal cancer patients.
24618891 2014 Genome-wide association study reveals two new risk loci for bipolar disorder.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24363043 2014 Non-raft adenylyl cyclase 2 defines a cAMP signaling compartment that selectively regulates IL-6 expression in airway smooth muscle cells: differential regulation of gene expression by AC isoforms.
23889134 2013 AKAP79, PKC, PKA and PDE4 participate in a Gq-linked muscarinic receptor and adenylate cyclase 2 cAMP signalling complex.
23504261 2013 Differential effects of AGS3 expression on D(2L) dopamine receptor-mediated adenylyl cyclase signaling.
22864933 2012 Identification of novel germline polymorphisms governing capecitabine sensitivity.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22461431 2012 CHRNA3/5, IREB2, and ADCY2 are associated with severe chronic obstructive pulmonary disease in Poland.
21528083 2011 SPARCL1, Shp2, MSH2, E-cadherin, p53, ADCY-2 and MAPK are prognosis-related in colorectal cancer.
More...