Property Summary

NCBI Gene PubMed Count 76
Grant Count 112
R01 Count 46
Funding $19,043,374.56
PubMed Score 527.63
PubTator Score 610.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.400 0.000
psoriasis -2.000 0.000
glioblastoma 1.800 0.001
pediatric high grade glioma 1.400 0.001
pilocytic astrocytoma 1.200 0.000
non-inflammatory breast cancer -1.500 0.010
gastric carcinoma 1.200 0.013
invasive ductal carcinoma -1.500 0.004

Synonym

Accession Q08431 B2R6M7 Q53FU9 Q7Z3D2 Q9BTL9
Symbols BA46
HMFG
MFGM
SED1
hP47
EDIL1
MFG-E8
SPAG10
OAcGD3S
HsT19888

Gene

Gene RIF (44)

PMID Text
26819373 After myocardial infarction, Mfge8 (and Mertk)-expressing macrophages synergistically engage the clearance of injured cardiomyocytes.
25751740 Studied the therapeutic effect of rhMFG-E8 in mouse models of IBD. Treatment with rhMFG-E8 significantly attenuated colitis in both models in a dose-dependent way.
25264705 promotes tumor progression in oral squamous cell carcinoma
24958900 Exogenously added MFG-E8 inhibits receptor activator NF-kappaB ligand-induced osteoclastogenesis of human osteoclast precursors.
24838098 MFG-E8 promotes cutaneous wound healing by enhancing angiogenesis.
24602872 medin adopts a predominantly beta-sheet conformation with some unstructured elements.
24561551 MFG-E8 had a negative association with hs-CRP and a positive association with LDL-c. The serum level of MFG-E8 was negatively associated with the severity of coronary artery stenosis and the risk of clinical events.
24554711 MFG-E8 could be used as a biomarker for diagnosis and monitoring of disease activity in certain systemic lupus erythematosus patients
24424369 Blockage of MFG-E8 in endometrial tumor cells diminishes trophoblaast cell attachment.
24262600 TNF-alpha up-regulates endometrial epithelial cell migration and MFG-E8 production.
More...

AA Sequence

MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKC      1 - 70
VEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTG     71 - 140
VVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPT    141 - 210
SCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVA    211 - 280
GSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN    281 - 350
HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC                                     351 - 387
//

Text Mined References (81)

PMID Year Title
26819373 2016 Myeloid-Epithelial-Reproductive Receptor Tyrosine Kinase and Milk Fat Globule Epidermal Growth Factor 8 Coordinately Improve Remodeling After Myocardial Infarction via Local Delivery of Vascular Endothelial Growth Factor.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25936372 2015 MFG-E8 inhibits neutrophil migration through ?v??-integrin-dependent MAP kinase activation.
25751740 2015 Recombinant human MFG-E8 ameliorates colon damage in DSS- and TNBS-induced colitis in mice.
25614623 2015 Comparisons with amyloid-? reveal an aspartate residue that stabilizes fibrils of the aortic amyloid peptide medin.
25264705 2014 MFG-E8 expression for progression of oral squamous cell carcinoma and for self-clearance of apoptotic cells.
24958900 2014 Regulation of osteoclast homeostasis and inflammatory bone loss by MFG-E8.
24838098 2014 MFG-E8 regulates angiogenesis in cutaneous wound healing.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24602872 2014 Expression and purification of the aortic amyloid polypeptide medin.
More...