Property Summary

NCBI Gene PubMed Count 85
PubMed Score 560.88
PubTator Score 610.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.5e-06
Breast cancer -1.500 2.5e-10
gastric carcinoma 1.200 1.3e-02
glioblastoma 1.800 1.3e-03
invasive ductal carcinoma -1.500 4.5e-03
malignant mesothelioma -3.400 2.1e-08
pediatric high grade glioma 1.400 6.1e-04
psoriasis -2.000 1.5e-05

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (51)

AA Sequence

MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKC      1 - 70
VEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTG     71 - 140
VVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPT    141 - 210
SCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVA    211 - 280
GSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN    281 - 350
HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC                                     351 - 387
//

Text Mined References (90)

PMID Year Title