Property Summary

NCBI Gene PubMed Count 76
PubMed Score 527.63
PubTator Score 610.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 2.05136595966635E-8
pilocytic astrocytoma 3086 4.91458210132981E-6
psoriasis 6685 1.52569525085054E-5
pediatric high grade glioma 2712 6.10151531944767E-4
glioblastoma 5572 0.00129537361096371
invasive ductal carcinoma 2950 0.00445742530569657
non-inflammatory breast cancer 208 0.0100319052480971
gastric carcinoma 832 0.0132325079737081
Disease Target Count Z-score Confidence
Cancer 2346 3.86 1.9
Simultanagnosia 2 3.739 1.9
Schizophrenia 503 3.66 1.8
Hidrocystoma 4 3.443 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.400 0.000
psoriasis -2.000 0.000
glioblastoma 1.800 0.001
pediatric high grade glioma 1.400 0.001
pilocytic astrocytoma 1.200 0.000
non-inflammatory breast cancer -1.500 0.010
gastric carcinoma 1.200 0.013
invasive ductal carcinoma -1.500 0.004

Synonym

Accession Q08431 B2R6M7 Q53FU9 Q7Z3D2 Q9BTL9
Symbols BA46
HMFG
MFGM
SED1
hP47
EDIL1
MFG-E8
SPAG10
OAcGD3S
HsT19888

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (44)

PMID Text
26819373 After myocardial infarction, Mfge8 (and Mertk)-expressing macrophages synergistically engage the clearance of injured cardiomyocytes.
25751740 Studied the therapeutic effect of rhMFG-E8 in mouse models of IBD. Treatment with rhMFG-E8 significantly attenuated colitis in both models in a dose-dependent way.
25264705 promotes tumor progression in oral squamous cell carcinoma
24958900 Exogenously added MFG-E8 inhibits receptor activator NF-kappaB ligand-induced osteoclastogenesis of human osteoclast precursors.
24838098 MFG-E8 promotes cutaneous wound healing by enhancing angiogenesis.
24602872 medin adopts a predominantly beta-sheet conformation with some unstructured elements.
24561551 MFG-E8 had a negative association with hs-CRP and a positive association with LDL-c. The serum level of MFG-E8 was negatively associated with the severity of coronary artery stenosis and the risk of clinical events.
24554711 MFG-E8 could be used as a biomarker for diagnosis and monitoring of disease activity in certain systemic lupus erythematosus patients
24424369 Blockage of MFG-E8 in endometrial tumor cells diminishes trophoblaast cell attachment.
24262600 TNF-alpha up-regulates endometrial epithelial cell migration and MFG-E8 production.
More...

AA Sequence

MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKC      1 - 70
VEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTG     71 - 140
VVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPT    141 - 210
SCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVA    211 - 280
GSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN    281 - 350
HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC                                     351 - 387
//

Text Mined References (81)

PMID Year Title
26819373 2016 Myeloid-Epithelial-Reproductive Receptor Tyrosine Kinase and Milk Fat Globule Epidermal Growth Factor 8 Coordinately Improve Remodeling After Myocardial Infarction via Local Delivery of Vascular Endothelial Growth Factor.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25936372 2015 MFG-E8 inhibits neutrophil migration through ?v??-integrin-dependent MAP kinase activation.
25751740 2015 Recombinant human MFG-E8 ameliorates colon damage in DSS- and TNBS-induced colitis in mice.
25614623 2015 Comparisons with amyloid-? reveal an aspartate residue that stabilizes fibrils of the aortic amyloid peptide medin.
25264705 2014 MFG-E8 expression for progression of oral squamous cell carcinoma and for self-clearance of apoptotic cells.
24958900 2014 Regulation of osteoclast homeostasis and inflammatory bone loss by MFG-E8.
24838098 2014 MFG-E8 regulates angiogenesis in cutaneous wound healing.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24602872 2014 Expression and purification of the aortic amyloid polypeptide medin.
More...