Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
R01 Count 1
Funding $77,000
PubMed Score 101.18
PubTator Score 60.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q08426 A8K6Y3 B4DWG3 D3DNU0 Q58EZ5 PBE
Symbols LBP
ECHD
LBFP
PBFE
FRTS3
L-PBE

Gene

PANTHER Protein Class (2)

 Grant Application (1)

 GWAS Trait (1)

Gene RIF (4)

PMID Text
24401050 Mistargeting of peroxisomal EHHADH disrupts mitochondrial metabolism and leads to renal Fanconi's syndrome; this indicates a central role of mitochondria in proximal tubular function.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGFSAPR      1 - 70
TFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLP     71 - 140
RLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMD    141 - 210
SIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANK    211 - 280
WSTPSGASWKTASARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASK    281 - 350
MQQSGHPWSGPKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS    351 - 420
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYN    421 - 490
QAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCP    491 - 560
IPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINE    561 - 630
AFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKK    631 - 700
LASQGNPPLKEWQSLAGSPSSKL                                                   701 - 723
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24401050 2014 Mistargeting of peroxisomal EHHADH and inherited renal Fanconi's syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20167786 2010 Regulation of cellular metabolism by protein lysine acetylation.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
More...