Property Summary

NCBI Gene PubMed Count 17
PubMed Score 109.33
PubTator Score 60.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.5e-03
colon cancer -1.500 3.9e-02
cystic fibrosis 1.307 5.4e-04
ductal carcinoma in situ -1.400 2.9e-03
interstitial cystitis -1.200 7.6e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
invasive ductal carcinoma -1.700 5.6e-03
lung cancer -1.700 6.1e-03
malignant mesothelioma -1.600 1.7e-06
nephrosclerosis -1.128 3.0e-02
pancreatic ductal adenocarcinoma liver m... -2.336 8.7e-03
ulcerative colitis -1.200 1.3e-03

Gene RIF (4)

AA Sequence

MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGFSAPR      1 - 70
TFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLP     71 - 140
RLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMD    141 - 210
SIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANK    211 - 280
WSTPSGASWKTASARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASK    281 - 350
MQQSGHPWSGPKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS    351 - 420
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYN    421 - 490
QAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCP    491 - 560
IPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINE    561 - 630
AFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKK    631 - 700
LASQGNPPLKEWQSLAGSPSSKL                                                   701 - 723
//

Text Mined References (25)

PMID Year Title