Property Summary

NCBI Gene PubMed Count 132
PubMed Score 364.64
PubTator Score 225.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Bladder Neoplasm 112

Expression

Gene RIF (146)

AA Sequence

MALARGSRQLGALVWGACLCVLVHGQQAQPGQGSDPARWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSE      1 - 70
SSSRVLLAGAPQAQQRRSHGSPRRRQAPSLPLPGRVGSDTVRGQARHPFGFGQVPDNWREVAVGDSTGMA     71 - 140
RARTSVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYPQAPFVSQYENYDPASRTYDQGFVYYRPAGG    141 - 210
GVGAGAAAVASAGVIYPYQPRARYEEYGGGEELPEYPPQGFYPAPERPYVPPPPPPPDGLDRRYSHSLYS    211 - 280
EGTPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQ    281 - 350
QGRLSVGSVYRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAPEATDYDVRVLL    351 - 420
RFPQRVKNQGTADFLPNRPRHTWEWHSCHQHYHSMDEFSHYDLLDAATGKKVAEGHKASFCLEDSTCDFG    421 - 490
NLKRYACTSHTQGLSPGCYDTYNADIDCQWIDITDVQPGNYILKVHVNPKYIVLESDFTNNVVRCNIHYT    491 - 560
GRYVSATNCKIVQS                                                            561 - 574
//

Text Mined References (135)

PMID Year Title