Property Summary

NCBI Gene PubMed Count 83
PubMed Score 736.17
PubTator Score 179.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

 GO Function (1)

Gene RIF (60)

AA Sequence

MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENA      1 - 70
TQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELS     71 - 140
EALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLR    141 - 210
YFYSRRIDITLSSVKCFHKLASAYGARQLQGYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCL    211 - 280
QFLAWNFEALTQAEAWPSVPTDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPM    281 - 350
MLPEELFELQFNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD    351 - 420
SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCW    421 - 490
NYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGWKAAIPSALDTNSSKSTSSFP    491 - 560
CPAGHFNGFRTVIRPFYLTNSSGVD                                                 561 - 585
//

Text Mined References (91)

PMID Year Title