| Tbio | Galectin-3-binding protein |
Promotes intergrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1. [provided by RefSeq, Jul 2008]
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1. [provided by RefSeq, Jul 2008]
Comments
Property Summary
| NCBI Gene PubMed Count | 73 |
| Grant Count | 23 |
| R01 Count | 8 |
| Funding | $4,333,441.91 |
| PubMed Score | 669.74 |
| PubTator Score | 179.03 |
| PMID | Text |
|---|---|
| 26503549 | three uniquely identified proteins (CDK6 , galectin-3-binding protein and LDH C) were found, which show tight connection with prostate cancer and presence of all of them was previously linked to certain aspects of prostate cancer |
| 26502662 | findings may help clarify the molecular mechanism of the tumor-suppressive effect through down-regulation of LGALS3BP by miR-596 in Oral Squamous Cell Carcinoma |
| 26448934 | 90K/Mac-2BP correlated with the size of colorectal cancer. |
| 26219351 | These results provide evidence that low expression of LGALS3BP participates in malignant progression of colorectal cancer. |
| 26168351 | study elucidates the specificity of Gal-3BP interacting with galectin-1 and the role of Gal-3BP in cancer cell aggregation and metastasis |
| 26124285 | Results provide direct evidence for the involvement of CALU and LGALS3BP as potential negative regulators in the virus-triggered induction of the typeI interferons. |
| 26070204 | Post-Tx WFA+-M2BP (> 2.0 COI) is associated with the risk for development of HCC among patients with SVR. The WFA+-M2BP values could be a new predictor for HCC after SVR. |
| 25320078 | These findings suggest a novel immunoinhibitory function for LGALS3BP that might be important for immune evasion of tumor cells during cancer progression. |
| 25013204 | Gal-3BP levels in patients with haemorrhagic fever with renal syndrome correlated with increased complement activation and with clinical variables reflecting the severity of acute hantavirus infection. |
| 24362527 | LGALS3BP-mediated integrin activation results into signal transmission via Akt, JNK and the Ras cascade via the Raf-ERK axis while p38 activity is kept at baseline levels |
| More... |
MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENA 1 - 70 TQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELS 71 - 140 EALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLR 141 - 210 YFYSRRIDITLSSVKCFHKLASAYGARQLQGYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCL 211 - 280 QFLAWNFEALTQAEAWPSVPTDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPM 281 - 350 MLPEELFELQFNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD 351 - 420 SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCW 421 - 490 NYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGWKAAIPSALDTNSSKSTSSFP 491 - 560 CPAGHFNGFRTVIRPFYLTNSSGVD 561 - 585 //
| PMID | Year | Title |
|---|---|---|
| 26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. |
| 26503549 | 2015 | Differences in urinary proteins related to surgical margin status after radical prostatectomy. |
| 26502662 | 2015 | Exploration of Alternative Mechanism for MiR-596-mediated Down-regulation of LGALS3BP in Oral Squamous Cell Carcinoma. |
| 26448934 | 2015 | Circulating Galectin-1 and 90K/Mac-2BP Correlated with the Tumor Stages of Patients with Colorectal Cancer. |
| 26219351 | 2015 | Prognostic relevance of LGALS3BP in human colorectal carcinoma. |
| 26168351 | 2015 | Galectin-3 Binding Protein and Galectin-1 Interaction in Breast Cancer Cell Aggregation and Metastasis. |
| 26124285 | 2015 | Quantitative Proteomics Reveals the Roles of Peroxisome-associated Proteins in Antiviral Innate Immune Responses. |
| 26070204 | 2015 | Serum Wisteria Floribunda Agglutinin-Positive Mac-2 Binding Protein Values Predict the Development of Hepatocellular Carcinoma among Patients with Chronic Hepatitis C after Sustained Virological Response. |
| 25645918 | 2015 | Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum. |
| 25320078 | 2014 | Lectin galactoside-binding soluble 3 binding protein (LGALS3BP) is a tumor-associated immunomodulatory ligand for CD33-related Siglecs. |
| More... |
