Property Summary

NCBI Gene PubMed Count 74
Grant Count 35
R01 Count 27
Funding $2,356,102.49
PubMed Score 80.52
PubTator Score 64.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.700 0.000
glioblastoma -1.100 0.004
atypical teratoid / rhabdoid tumor -1.100 0.000

Gene RIF (20)

PMID Text
26742501 We describe the first human patient with a homozygous apparently loss of function mutation in GOLGA2. The phenotype is a neuromuscular disorder characterized by developmental delay, seizures, progressive microcephaly, and muscular dystrophy.
26687599 Data show that WAC directly binds to GM130 and that this binding is required for autophagosome formation through interacting with GABARAP regulating its subcellular localization.
26617790 GM130 upregulated expression of the key epithelial-mesenchymal transformation regulator Snail (SNAI1), which mediated EMT activation and cell invasion by GM130.
26363069 Mutagenesis experiments support these structural observations and demonstrate that they are required for GRASP65-GM130 association.
26314804 the study identified GM130 as a novel target of Coxsackievirus B3 (CVB3), which may implicate in the pathogenesis of CVB3-induced acute pancreatitis.
25892554 Depletion of GM130 increases cellular velocity and increases the invasiveness of breast cancer cells, therefore supporting the view that alterations of polarity contribute to tumor progression.
25787021 GM130 is a parallel homotetramer with a flexible rod-like structure with I- and Y-shaped conformations.
25496667 Genome-wide shRNA screening identifies GOLGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24386440 H-ERG trafficking was impaired by H2O2 after 48 h treatment, accompanied by reciprocal changes of expression between miR-17-5p seed miRNAs and several chaperones (Hsp70, Hsc70, CANX, and Golga20)
22735382 Induction of autophagy by shGOLGA2 may induce cell death rather than cell survival. Downregulation of GOLGA2/GM130 may be a potential therapeutic option for lung cancer.
More...

AA Sequence

MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDT      1 - 70
PKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCE     71 - 140
SATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQG    141 - 210
ALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQK    211 - 280
KADRYNKELTKERDALRLELYKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQ    281 - 350
QFSSRCEAPDANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHT    351 - 420
LREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLAGQLQAQVQDN    421 - 490
EGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLT    491 - 560
NENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLT    561 - 630
SEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDG    631 - 700
LDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAH    701 - 770
LLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGET    771 - 840
DTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWHGRFLAAAQNP    841 - 910
ADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTAQQIMQLLREMQNPRERPGLG    911 - 980
SNPCIPFFYRADENDEVKITVI                                                    981 - 1002
//

Text Mined References (83)

PMID Year Title
26742501 2016 GOLGA2, encoding a master regulator of golgi apparatus, is mutated in a patient with a neuromuscular disorder.
26687599 2015 Activation of ULK Kinase and Autophagy by GABARAP Trafficking from the Centrosome Is Regulated by WAC and GM130.
26617790 2015 GM130 regulates epithelial-to-mesenchymal transition and invasion of gastric cancer cells via snail.
26363069 2015 Structural basis for the interaction between the Golgi reassembly-stacking protein GRASP65 and the Golgi matrix protein GM130.
26314804 2015 Identification of the interaction of VP1 with GM130 which may implicate in the pathogenesis of CVB3-induced acute pancreatitis.
26165940 2015 GM130 Regulates Golgi-Derived Spindle Assembly by Activating TPX2 and Capturing Microtubules.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25892554 2015 Loss of GM130 in breast cancer cells and its effects on cell migration, invasion and polarity.
25787021 2015 GM130 is a parallel tetramer with a flexible rod-like structure and N-terminally open (Y-shaped) and closed (I-shaped) conformations.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
More...