Property Summary

NCBI Gene PubMed Count 128
Grant Count 197
R01 Count 119
Funding $24,616,534.01
PubMed Score 0.00
PubTator Score 151.05

Knowledge Summary

Patent (14,880)

Expression

  Differential Expression (17)

Synonym

Accession Q08345 B5A975 B5A976 B7Z2K0 Q14196 Q16562 Q2L6H3 Q4LE50 Q5ST11 Q5ST12 Q6NSK4 Q9UD35 Q9UD36 Q9UD37 Q9UD86 Q9UDL2 Epithelial discoidin domain receptor 1
Symbols CAK
DDR
NEP
HGK2
PTK3
RTK6
TRKE
CD167
EDDR1
MCK10
NTRK4
PTK3A

Gene

PDB

3ZOS   4AG4   4BKJ   4CKR   5BVK   5BVN   5BVO   5BVW   5FDP  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (91)

PMID Text
26719540 DDR1 is a key modulator of RIT activity.
26702058 Data suggest SCl2 (Streptococcus pyogenes) binds to DDR (DDR1, DDR2) ectodomain w/o stimulating receptor signaling; here, protein engineering was used to construct SCl-like proteins that inhibit collagen-DDR interactions and macrophage migration.
26589794 Knockdown DDR1 reversed the effects of Galpha13 knockdown on cell-cell adhesion and proteolytic invasion in three-dimensional collagen.
26297342 DDR1 expression is a prognostic indicator in pancreatic ductal carcinoma.
26286316 Hypoxia can increase DDR1 expression in pituitary adenoma cells, leading to improved MMP-2 and MMP-9 secretion, and promoting pituitary adenoma cell proliferation and invasion.
25992553 alpha5(IV), but not alpha1(IV), promotes lung cancer cell proliferation and tumor angiogenesis through non-integrin collagen receptor DDR1-mediated ERK activation.
25774665 MT1-MMP-discoidin domain receptor 1 axis regulates collagen-induced apoptosis in breast cancer cells
25673773 suggest that DDR1 suppression may enhance adipose-derived stem cell chondrogenesis by enhancing the expression of chondrogenic genes and cartilaginous matrix deposition.
25667101 A DDR1(Low)/DDR2(High) protein profile is associated with TNBC and may identify invasive carcinomas with worse prognosis.
25470979 Defective Ca(2+) binding in a conserved binding site causes incomplete N-glycan processing and endoplasmic reticulum trapping of DDR1 and DDR2 receptors.
More...

AA Sequence

MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD      1 - 70
GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV     71 - 140
ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL    141 - 210
NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF    211 - 280
QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF    281 - 350
LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI    351 - 420
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR    421 - 490
GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP    491 - 560
PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD    561 - 630
SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI    631 - 700
TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR    701 - 770
NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC    771 - 840
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL    841 - 910
NTV                                                                       911 - 913
//

Text Mined References (137)

PMID Year Title
26719540 2016 Anticancer Effects of Mesothelin-Targeted Immunotoxin Therapy Are Regulated by Tyrosine Kinase DDR1.
26702058 2016 Recombinant Collagen Engineered to Bind to Discoidin Domain Receptor Functions as a Receptor Inhibitor.
26589794 2016 Cancer Cell Invasion in Three-dimensional Collagen Is Regulated Differentially by G?13 Protein and Discoidin Domain Receptor 1-Par3 Protein Signaling.
26297342 2015 High expression of DDR1 is associated with the poor prognosis in Chinese patients with pancreatic ductal adenocarcinoma.
26286316 2015 Effect of Hypoxia on DDR1 Expression in Pituitary Adenomas.
25992553 2015 Minor Type IV Collagen ?5 Chain Promotes Cancer Progression through Discoidin Domain Receptor-1.
25774665 2015 A membrane-type-1 matrix metalloproteinase (MT1-MMP)-discoidin domain receptor 1 axis regulates collagen-induced apoptosis in breast cancer cells.
25673773 2015 Suppression of discoidin domain receptor 1 expression enhances the chondrogenesis of adipose-derived stem cells.
25667101 2015 Tyrosine kinase discoidin domain receptors DDR1 and DDR2 are coordinately deregulated in triple-negative breast cancer.
25470979 2015 Defective Ca(2+) binding in a conserved binding site causes incomplete N-glycan processing and endoplasmic reticulum trapping of discoidin domain receptors.
More...