Property Summary

Ligand Count 57
NCBI Gene PubMed Count 137
PubMed Score 0.00
PubTator Score 151.05

Knowledge Summary

Patent (14,880)

TINX Plot

  Disease (6)

Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.821 1.9
Vitiligo 73 3.299 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.400 1.9e-04
astrocytic glioma 1.700 3.2e-03
Astrocytoma, Pilocytic 1.600 9.0e-09
atypical teratoid / rhabdoid tumor 1.300 1.9e-05
Down syndrome 1.100 9.2e-04
ductal carcinoma in situ 1.500 2.8e-03
ependymoma 1.700 7.0e-03
glioblastoma 1.100 5.6e-07
interstitial cystitis -1.300 1.9e-03
invasive ductal carcinoma 1.500 4.4e-02
lung adenocarcinoma 1.234 1.0e-06
medulloblastoma, large-cell -2.000 5.1e-04
non-small cell lung cancer 1.430 3.8e-14
oligodendroglioma 2.000 1.5e-03
ovarian cancer 1.700 9.1e-05
pancreatic ductal adenocarcinoma liver m... 1.476 2.0e-02
primitive neuroectodermal tumor 1.100 4.2e-03

PDB (10)

Gene RIF (100)

AA Sequence

MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD      1 - 70
GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV     71 - 140
ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL    141 - 210
NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF    211 - 280
QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF    281 - 350
LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI    351 - 420
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR    421 - 490
GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP    491 - 560
PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD    561 - 630
SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI    631 - 700
TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR    701 - 770
NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC    771 - 840
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL    841 - 910
NTV                                                                       911 - 913
//

Text Mined References (146)

PMID Year Title