Property Summary

NCBI Gene PubMed Count 78
PubMed Score 57.27
PubTator Score 65.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 1.0e-06
diabetes mellitus -1.600 1.6e-03
glioblastoma 1.300 3.0e-07
group 3 medulloblastoma 1.100 6.2e-03
lung cancer -1.200 5.9e-03
ovarian cancer -1.400 2.0e-06
pediatric high grade glioma 1.300 1.1e-05
posterior fossa group A ependymoma 1.100 4.3e-07
subependymal giant cell astrocytoma 1.546 1.0e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (56)

AA Sequence

MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTT      1 - 70
LTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEY     71 - 140
ETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCE    141 - 210
QTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLF    211 - 280
FSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS                             281 - 325
//

Text Mined References (81)

PMID Year Title