Property Summary

NCBI Gene PubMed Count 73
Grant Count 24
R01 Count 20
Funding $1,666,978.93
PubMed Score 55.53
PubTator Score 65.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.300 0.000
lung cancer -1.300 0.014
diabetes mellitus -1.600 0.002
pediatric high grade glioma 1.300 0.000
group 3 medulloblastoma 1.100 0.006
pilocytic astrocytoma 1.300 0.000
posterior fossa group A ependymoma 1.100 0.000
subependymal giant cell astrocytoma 1.546 0.010
ovarian cancer -1.400 0.000

 GO Function (1)

Gene RIF (53)

PMID Text
26130064 IL10R2 Overexpression promotes IL22/STAT3 signaling in colorectal carcinogenesis.
25733167 High IL10RB expression is associated with diffuse large B-cell lymphoma.
25373860 genetic association study in cohort of infants/children: Data suggest perianal fistulas are exhibited in patients with very early-onset inflammatory bowel disease with IL10 receptor mutations (IL10RA/B); prognosis and response to treatment are poor.
25032264 PAPL, IL10RB and DEPDC5 polymorphisms have an impact on progression of hepatitis B virus-related liver disease.
24785691 Inflammatory bowel disease (IBD) in infancy is phenotypically and genetically different disease entity from adult-onset or older child-onset IBD. It has a strong association with IL-10 receptor gene.
24581234 No evidence for an involvement of autoantibodies against IL-10 or IL-10R in the pathogenesis of inflammatory bowel disease could be established.
24379584 Case Report: pediatric ulcerative colitis patient compound heterozygote for the IL10RB E47K polymorphism, inherited from his father.
24216686 Mutations in the IL10RB gene is associated with ulcerative colitis.
24144988 Results show that the distribution of IL10RB and IL28RA genotypes among the Hepatitis C virus-infected and control groups did not differ significantly.
24089328 5 patients with an IL-10R1 or IL-10R2 deficiency developed B-cell non-Hodgkin lymphoma between the ages of 5 and 6 years (which was recurrent in 1 patient).
More...

AA Sequence

MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTT      1 - 70
LTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEY     71 - 140
ETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCE    141 - 210
QTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLF    211 - 280
FSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS                             281 - 325
//

Text Mined References (77)

PMID Year Title
26130064 2015 IL10R2 Overexpression Promotes IL22/STAT3 Signaling in Colorectal Carcinogenesis.
25733167 2015 IL10 receptor is a novel therapeutic target in DLBCLs.
25373860 2015 Clinical features of interleukin 10 receptor gene mutations in children with very early-onset inflammatory bowel disease.
25032264 2014 Role of IFN-ks, IFN-ks related genes and the DEPDC5 gene in Hepatitis B virus-related liver disease.
24785691 2014 Very early-onset inflammatory bowel disease (IBD) in infancy is a different disease entity from adult-onset IBD; one form of interleukin-10 receptor mutations.
24581234 2014 Evidence for non-neutralizing autoantibodies against IL-10 signalling components in patients with inflammatory bowel disease.
24379584 2013 Synergistic effect of interleukin-10-receptor variants in a case of early-onset ulcerative colitis.
24216686 2013 Phenotypic characterization of very early-onset IBD due to mutations in the IL10, IL10 receptor alpha or beta gene: a survey of the Genius Working Group.
24204295 2013 Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic.
24144988 2014 Evaluation of the relationship between IL28B, IL10RB and IL28RA single-nucleotide polymorphisms and susceptibility to hepatitis C virus in Chinese Han population.
More...