Property Summary

NCBI Gene PubMed Count 66
PubMed Score 25.45
PubTator Score 26.16

Knowledge Summary

Patent (1,925)

TINX Plot

  Disease (7)

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.700 4.8e-04
astrocytic glioma -1.800 1.5e-02
Astrocytoma, Pilocytic -1.100 1.3e-02
atypical teratoid / rhabdoid tumor -3.300 3.7e-08
chronic lymphosyte leukemia 1.200 1.1e-02
colon cancer -1.800 3.6e-02
cutaneous lupus erythematosus -1.100 2.8e-03
ependymoma -1.900 2.1e-02
glioblastoma -1.100 2.6e-04
group 3 medulloblastoma -1.600 4.0e-02
intraductal papillary-mucinous adenoma (... -1.100 9.2e-06
intraductal papillary-mucinous neoplasm ... -1.200 6.2e-04
lung carcinoma 1.300 1.5e-13
medulloblastoma, large-cell -2.400 3.7e-04
oligodendroglioma -1.900 2.0e-02
osteosarcoma -3.483 7.6e-11
ovarian cancer -3.100 1.2e-29
Pick disease -1.300 1.1e-02
primitive neuroectodermal tumor -2.300 8.0e-04
psoriasis -2.100 9.7e-05
subependymal giant cell astrocytoma -2.456 1.7e-02

 IMPC Phenotype (1)

 OMIM Phenotype (1)

Gene RIF (31)

AA Sequence

MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVR      1 - 70
QGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAI     71 - 140
SFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLGD    141 - 210
IVPSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPS    211 - 280
MRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSS    281 - 350
LAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN    351 - 420
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPT    421 - 490
LASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQ    491 - 560
ESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKS    561 - 630
KDRYCEKDGEVISKKRNEAGEWNRDVYIRQ                                            631 - 660
//

Text Mined References (69)

PMID Year Title