Property Summary

NCBI Gene PubMed Count 93
Grant Count 114
R01 Count 78
Funding $17,875,644.66
PubMed Score 693.67
PubTator Score 137.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.380 0.001
astrocytic glioma 1.900 0.002
ependymoma 2.400 0.001
oligodendroglioma 2.600 0.001
psoriasis -2.700 0.000
osteosarcoma 1.374 0.004
group 4 medulloblastoma 2.400 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.800 0.000
medulloblastoma, large-cell 2.900 0.000
primitive neuroectodermal tumor 1.400 0.000
lung cancer 1.400 0.031
pediatric high grade glioma 1.400 0.002
Gaucher disease type 1 -2.600 0.003

Synonym

Accession Q08211 B2RNV4 Q05CI5 Q12803 Q32Q22 Q5VY62 Q6PD69 Q99556 RHA
Symbols LKP
RHA
DDX9
NDH2
NDHII

Gene

PDB

3LLM   3VYX   3VYY  

Gene RIF (60)

PMID Text
26450900 Genotoxic stress inhibits Ewing sarcoma cell growth by modulating alternative pre-mRNA processing of the RNA helicase DHX9.
25496916 Interaction of HIV-1 Tat with RHA in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
25149208 OB-fold is involved in modulating HIV-1 RNA splicing in the context of some HIV-1 strains while it is dispensable for the activation of HIV-1 transcription.
24990949 results demonstrate an essential role of DHX9 in DNA replication and normal cell cycle progression.
24726449 The conserved lysine residues of dsRBDs play critical roles in the promotion of HIV-1 production by RNA helicase A.
24469107 Results show RNA helicase DHX9 as an interacting partner of KIF1Bbeta and found that DHX9 is necessary for KIF1Bbeta to induce apoptosis.
24223160 RNA helicase A participates in HIV-1 RNA metabolism by multiple distinct mechanisms.
24049074 The data implicate DHX9 in processing intra-molecular triplex H-DNA structures in vivo and support its role in the overall maintenance of genomic stability at sites of alternatively structured DNA.
23853588 Data suggest that M029 (an RNA-binding protein) plays pivotal role in determining cellular tropism of Myxoma virus in all mammalian cells tested; human RNA helicase A/DHX9 and protein kinase R/EIF2AK2 are two binding partners of M029.
23361462 The crystal structure of huma DHX9 RNA binding domains in complex with double stranded RNA.
More...

AA Sequence

MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLV      1 - 70
RINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWD     71 - 140
RGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRS    141 - 210
FIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQ    211 - 280
DLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQRQNQVGVVPWSPPQSNWNPWTSSNIDEG    281 - 350
PLAFATPEQISMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSVVIIRGATGCGKTTQ    351 - 420
VPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPGKSCGYSVRFESILPRPHASIMFCT    421 - 490
VGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPEVRIVLMSATIDTSMFCEYFFNCPI    491 - 560
IEVYGRTYPVQEYFLEDCIQMTHFVPPPKDKKKKDKDDDGGEDDDANCNLICGDEYGPETRLSMSQLNEK    561 - 630
ETPFELIEALLKYIETLNVPGAVLVFLPGWNLIYTMQKHLEMNPHFGSHRYQILPLHSQIPREEQRKVFD    631 - 700
PVPVGVTKVILSTNIAETSITINDVVYVIDSCKQKVKLFTAHNNMTNYATVWASKTNLEQRKGRAGRVRP    701 - 770
GFCFHLCSRARFERLETHMTPEMFRTPLHEIALSIKLLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELD    771 - 840
ALDANDELTPLGRILAKLPIEPRFGKMMIMGCIFYVGDAICTIAAATCFPEPFINEGKRLGYIHRNFAGN    841 - 910
RFSDHVALLSVFQAWDDARMGGEEAEIRFCEHKRLNMATLRMTWEAKVQLKEILINSGFPEDCLLTQVFT    911 - 980
NTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNALIHKSSVNCPFSSQDMKYPSPFFVFGEKIR    981 - 1050
TRAISAKGMTLVTPLQLLLFASKKVQSDGQIVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAI   1051 - 1120
ISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYS   1121 - 1190
SGGYGSGGYGGSANSFRAGYGAGVGGGYRGVSRGGFRGNSGGDYRGPSGGYRGSGGFQRGGGRGAYGTGY   1191 - 1260
FGQGRGGGGY                                                               1261 - 1270
//

Text Mined References (103)

PMID Year Title
26450900 2015 Genotoxic stress inhibits Ewing sarcoma cell growth by modulating alternative pre-mRNA processing of the RNA helicase DHX9.
25149208 2014 Role of the OB-fold of RNA helicase A in the synthesis of HIV-1 RNA.
24990949 2014 Suppression of the DHX9 helicase induces premature senescence in human diploid fibroblasts in a p53-dependent manner.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24726449 2014 Different activities of the conserved lysine residues in the double-stranded RNA binding domains of RNA helicase A in vitro and in the cell.
24469107 2014 RNA helicase A is a downstream mediator of KIF1B? tumor-suppressor function in neuroblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223160 2013 Roles of the linker region of RNA helicase A in HIV-1 RNA metabolism.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24049074 2013 DHX9 helicase is involved in preventing genomic instability induced by alternatively structured DNA in human cells.
More...