Property Summary

Ligand Count 20
NCBI Gene PubMed Count 117
PubMed Score 997.73
PubTator Score 60.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Corneal disease 31 0.0 1.1
Essential Hypertension 94 0.0 1.0
Disease Target Count
Keratoconus 113

Expression

  Differential Expression (26)

Protein-protein Interaction (3)

Gene RIF (65)

AA Sequence

MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGAS      1 - 70
ILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILY     71 - 140
PKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLD    141 - 210
DIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRA    211 - 280
HEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVF    281 - 350
TWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV    351 - 420
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM    421 - 490
PSDANLNSINKALTSETNGTDSNGSNSSNIQ                                           491 - 521
//

Text Mined References (126)

PMID Year Title