Property Summary

NCBI Gene PubMed Count 49
Grant Count 57
R01 Count 21
Funding $11,825,872.56
PubMed Score 471.09
PubTator Score 68.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -4.400 0.018
psoriasis 2.700 0.000

Synonym

Accession Q08188 A8K5N6 B2RCR6 D3DVX1 O95933 Q32ML9 Q32MM0
Symbols TGE

Gene

PANTHER Protein Class (2)

PDB

1L9M   1L9N   1NUD   1NUF   1NUG  

Gene RIF (31)

PMID Text
25178107 Transglutaminase 3 present in the IgA aggregates in dermatitis herpetiformis skin is enzymatically active and binds soluble fibrinogen.
24885370 IgA-anti-TG1 antibodies were found in 2% and IgA-anti-TG3 antibodies in 3% of patients with active atopic dermatitis (AD). Two out of the 5 patients with AD and concomitant celiac disease had IgA-anti-TG1 and IgA-anti-TG2 antibodies.
24403052 New basal cell carcinoma susceptibility loci were identified at TGM3 (rs214782) and RGS22(rs7006527).
24289313 TGM3, a candidate tumor suppressor, contributes to the carcinogenesis and development of human head and neck cancer.
24112124 mRNA expression of transglutaminase 1 and transglutaminase 3 was significantly decreased in patients with chronic periodontitis compared with a healthy control group.
23189155 Genetic variation in the epidermal transglutaminase genes is not associated with atopic dermatitis.
22506423 The low expression of TGM3 may contribute to the carcinogenesis and development of laryngeal carcinoma.
21335491 TGM3 in immunoglobulin A (IgA) and TGM3 immune complexes is responsible for cross-linking and tight binding of IgA to connective tissue in the dermis and explains the IgA deposits in dermatitis herpetiformis skin long after signs of disease are resolved.
20716179 new information on the specific distribution of TGase 3
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVSTGPYPSESAMT      1 - 70
KAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQGGISSVKLGTFILLFNPWLN     71 - 140
VDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQFEEDILSICLSILDRSLNFRRDAATDVASR    141 - 210
NDPKYVGRVLSAMINSNDDNGVLAGNWSGTYTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGTL    211 - 280
NTALRSLGIPSRVITNFNSAHDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGW    281 - 350
QVLDATPQERSQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDNTTGKQWKNSVNSHTIG    351 - 420
RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQEPSIIGKLKVA    421 - 490
GMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSATMSLDPEEEAEHPIKISYAQY    491 - 560
EKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLEVLNEARVRKPVNVQMLFSNPLDEPVRDCVL    561 - 630
MVEGSGLLLGNLKIDVPTLGPKEGSRVRFDILPSRSGTKQLLADFSCNKFPAIKAMLSIDVAE           631 - 693
//

Text Mined References (54)

PMID Year Title
25178107 2015 Transglutaminase 3 present in the IgA aggregates in dermatitis herpetiformis skin is enzymatically active and binds soluble fibrinogen.
24885370 2014 Low prevalence of IgA anti-transglutaminase 1, 2, and 3 autoantibodies in children with atopic dermatitis.
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
24289313 2013 TGM3, a candidate tumor suppressor gene, contributes to human head and neck cancer.
24112124 2014 Differential expression of transglutaminase genes in patients with chronic periodontitis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23189155 2012 Genetic variation in the epidermal transglutaminase genes is not associated with atopic dermatitis.
22506423 2012 [Expression of TGM3 protein and its significance in laryngeal carcinoma].
21335491 2011 Dermatitis herpetiformis sera or goat anti-transglutaminase-3 transferred to human skin-grafted mice mimics dermatitis herpetiformis immunopathology.
21282207 2011 Hornerin is a component of the epidermal cornified cell envelopes.
More...