Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
Funding $38,920.5
PubMed Score 20.50
PubTator Score 16.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Asthma 349 3.372 1.7
Carcinoma 2,147 1.0

Expression

Synonym

Accession Q08174 Q8IUP2
Symbols PC42
PCDH42

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
26227965 PCDH1 is important for airway function as a physical barrier, and its dysfunction is involved in the pathogenesis of allergic airway inflammation.
26209277 PCDH1 and SMAD3 act in a single pathway in asthma susceptibility that affects sensitivity of the airway epithelium to TGF-beta.
23988763 Common variations in PCDH1 increase the risk of developing both transient early asthma and atopic dermatitis in early childhood
23050600 genetic polymorphism is associated with subphenotypes of asthma in German children
21982948 PCDH1 transcripts display remarkable variability in expression of conserved intracellular signaling domains; enhanced PCDH1 expression levels strongly correlate with differentiation of bronchial epithelial cells.
21929597 PCDH1 gene variant IVS3-116 associates with eczema in two independent birth cohorts in Netherlands.
19729670 PCDH1 is a novel gene for BHR in adults and children. Its identification as a BHR susceptibility gene may suggest that a structural defect in the integrity of the airway epithelium and contributes to the development of BHR.

AA Sequence

MDSGAGGRRCPEAALLILGPPRMEHLRHSPGPGGQRLLLPSMLLALLLLLAPSPGHATRVVYKVPEEQPP      1 - 70
NTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSI     71 - 140
TDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAG    141 - 210
PEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKF    211 - 280
ERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDL    281 - 350
STLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVS    351 - 420
DRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTN    421 - 490
SLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPE    491 - 560
TGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP    561 - 630
VGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVG    631 - 700
VTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSH    701 - 770
SGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSLDTPLDIDIAG    771 - 840
DPEYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQREAKSGYQAGKKETKDLYAPKPSGKASKGNK    841 - 910
SKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPPGSPDLGRHYRSNSPLPSIQL    911 - 980
QPQSPSASKKHQVVQDLPPANTFVGTGDTTSTGSEQYSDYSYRTNPPKYPSKQVGQPFQLSTPQPLPHPY    981 - 1050
HGAIWTEVWE                                                               1051 - 1060
//

Text Mined References (28)

PMID Year Title
26227965 2015 Protocadherin-1 is a glucocorticoid-responsive critical regulator of airway epithelial barrier function.
26209277 2015 Protocadherin-1 binds to SMAD3 and suppresses TGF-?1-induced gene transcription.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988763 2014 The PCDH1 gene and asthma in early childhood.
23406873 2013 A genome-wide meta-analysis identifies two novel loci associated with high myopia in the Han Chinese population.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23050600 2012 Genetic variants in Protocadherin-1, bronchial hyper-responsiveness, and asthma subphenotypes in German children.
21982948 2012 Characterization of protocadherin-1 expression in primary bronchial epithelial cells: association with epithelial cell differentiation.
21929597 2012 Protocadherin-1 polymorphisms are associated with eczema in two Dutch birth cohorts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...