Property Summary

NCBI Gene PubMed Count 33
Grant Count 33
R01 Count 17
Funding $67,173,864.7
PubMed Score 129.53
PubTator Score 50.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.181 0.020
ependymoma -1.600 0.000
astrocytoma -1.400 0.035
lung cancer 1.100 0.013
interstitial cystitis -1.200 0.002
atypical teratoid/rhabdoid tumor -1.100 0.000
group 4 medulloblastoma 1.100 0.000
subependymal giant cell astrocytoma -1.006 0.045
lung adenocarcinoma -1.100 0.000
non-inflammatory breast cancer -1.400 0.004
ovarian cancer -1.400 0.000
dermatomyositis -1.400 0.003

Gene RIF (13)

PMID Text
26549228 AES is a transcriptional repressor for HNF-1-alpha in pancreatic beta-cell.
26229111 heat shock cognate 70 (HSC70) is an essential component of Aes foci in colorectal cancer cells.
23840876 GRG5/AES interacts with TCF4 and represses Wnt-mediated transcription both in human cells and zebrafish embryos.
23732115 AES binds to PROP1 and represses its expression; PROP1 mutation is a likely cause of combined pituitary hormone deficiency.
23546594 alteration of the malignant behavior of cancer cells by AES is related to RND3 regulation.
21937451 In the presence of NUP98-HOXA9, AES caused an increase in long-term proliferation of primary human CD34+ cells with a marked increase in the numbers of primitive cells.
21245488 Elevated levels of AES mRNA and protein were confirmed in AML1/ETO-expressing leukemia cells, as well as in other acute myeloid leukemia specimens.
20676368 LRP6-ICD interacts with AES exclusively in the nucleus and represses AES mediated TCF/LEF-1 reporter transcription.
20163360 Data report that the negative regulatory domain of AES inhibits AES dimerization and AES-mediated inhibition of AR-driven transcription through an interaction with the inhibitory domain.
19460752 Knockdown of amino-terminal enhancer of split (AES) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
More...

AA Sequence

MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG      1 - 70
LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALAL     71 - 140
PLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD                 141 - 197
//

Text Mined References (36)

PMID Year Title
26549228 2015 Repression of HNF1?-mediated transcription by amino-terminal enhancer of split (AES).
26229111 2016 Characterization of Aes nuclear foci in colorectal cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
23840876 2013 GRG5/AES interacts with T-cell factor 4 (TCF4) and downregulates Wnt signaling in human cells and zebrafish embryos.
23732115 2013 A PROP1-binding factor, AES cloned by yeast two-hybrid assay represses PROP1-induced Pit-1 gene expression.
23546594 2013 Suppression of RND3 activity by AES downregulation promotes cancer cell proliferation and invasion.
22952044 2012 TLE1 is an anoikis regulator and is downregulated by Bit1 in breast cancer cells.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
21937451 2011 Amino-terminal enhancer of split (AES) interacts with the oncoprotein NUP98-HOXA9 and enhances its transforming ability.
21245488 2011 AML1/ETO induces self-renewal in hematopoietic progenitor cells via the Groucho-related amino-terminal AES protein.
More...