Property Summary

NCBI Gene PubMed Count 35
PubMed Score 133.66
PubTator Score 50.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.400 3.5e-02
atypical teratoid/rhabdoid tumor -1.100 1.4e-04
dermatomyositis -1.400 2.9e-03
ependymoma -1.600 3.2e-07
group 4 medulloblastoma 1.100 4.7e-04
inflammatory breast cancer -1.300 3.3e-03
interstitial cystitis -1.200 2.0e-03
lung adenocarcinoma -1.100 7.1e-08
lung cancer 1.100 1.3e-02
osteosarcoma -1.181 2.0e-02
ovarian cancer -1.400 2.3e-09
psoriasis -1.600 1.2e-04
subependymal giant cell astrocytoma -1.006 4.5e-02

 GO Component (1)

Gene RIF (15)

AA Sequence

MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG      1 - 70
LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALAL     71 - 140
PLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD                 141 - 197
//

Text Mined References (38)

PMID Year Title