Property Summary

NCBI Gene PubMed Count 43
Grant Count 17
R01 Count 14
Funding $1,112,772.09
PubMed Score 97.81
PubTator Score 54.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.050
Multiple myeloma -1.023 0.028
urothelial carcinoma -3.800 0.001
esophageal adenocarcinoma 1.900 0.039
psoriasis -4.300 0.000
cutaneous lupus erythematosus 3.700 0.002
astrocytoma 2.300 0.000
glioblastoma 3.000 0.009
oligodendroglioma 1.600 0.000
periodontitis 1.800 0.000
medulloblastoma, large-cell -1.600 0.006
Atopic dermatitis 2.700 0.000
tuberculosis -3.700 0.000
intraductal papillary-mucinous carcinoma... -1.500 0.033
lung cancer -2.900 0.000
pancreatic cancer 1.100 0.030
breast carcinoma 1.500 0.007
adult high grade glioma 1.900 0.001
group 4 medulloblastoma -1.600 0.001
pilocytic astrocytoma 1.700 0.005
posterior fossa group A ependymoma 1.800 0.000
primary Sjogren syndrome 2.100 0.000
invasive ductal carcinoma 3.900 0.000
inflammatory breast cancer -2.300 0.000
lung carcinoma -2.100 0.000
non-small cell lung carcinoma 1.200 0.000
ductal carcinoma in situ 2.700 0.003
ulcerative colitis 3.700 0.000
ovarian cancer 3.800 0.000
Down syndrome 2.700 0.013

Gene RIF (27)

PMID Text
26222051 RGS1 as a potential marker of CRC tissue quality
25897806 RGS1 suppresses CXCL12-mediated migration and AKT activation in cultured human plasmacytoma cells and plasmablasts.
25782711 Rgs1 has a role in leukocyte trafficking and vascular inflammation
24162774 HIV-1 gp120 upregulates the expression of regulator of G-protein signaling 1 (RGS1) in human B cells
24130709 RGS1 and TNFRSF1A polymorphisms tended to be associated with reduced attack severity in Multiple sclerosis.
23898208 HIV-1 gp120 upregulates the expression of regulator of G-protein signaling 1 (RGS1) in human B cells
23464602 RGS1 is largely upregulated, whereas RGS2 is downregulated in the majority of solid tumors, whereas RGS5 transcripts are greatly increased in eight subtypes of lymphoma with no reports of downregulation in hematological malignancies
23324853 Markers in the RGS1 gene might be in linkage disequilibrium with a protective allele that reduces the risk of anxiety and depressive disorders.
21795595 Elevated RGS1 levels profoundly reduce T cell migration to lymphoid-homing chemokines
20647273 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKS      1 - 70
KDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF     71 - 140
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK     141 - 209
//

Text Mined References (42)

PMID Year Title
26222051 2015 Identification and Validation of a Potential Marker of Tissue Quality Using Gene Expression Analysis of Human Colorectal Tissue.
25897806 2015 Regulator of G protein signaling 1 suppresses CXCL12-mediated migration and AKT activation in RPMI 8226 human plasmacytoma cells and plasmablasts.
25782711 2015 RGS1 regulates myeloid cell accumulation in atherosclerosis and aortic aneurysm rupture through altered chemokine signalling.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23324853 2013 Genetic association between RGS1 and internalizing disorders.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21795595 2011 Cutting Edge: Regulator of G protein signaling-1 selectively regulates gut T cell trafficking and colitic potential.
20647273 2010 Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...