1. Home
  2. Targets
  3. enzyme modulator
  4. G-protein modulator
  5. Regulator of G-protein signaling 1

Tbio Regulator of G-protein signaling 1

Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the N-formylpeptide chemoattractant receptors and leukotriene receptors (PubMed:10480894). Inhibits B cell chemotaxis toward CXCL12 (By similarity). Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form (PubMed:10480894, PubMed:18434541).

This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 43
PubMed Score 97.81
PubTator Score 54.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
periodontitis 269 2.46155895559962E-19
astrocytoma 1493 6.23583248345987E-13
non-small cell lung carcinoma 413 8.46466097262945E-12
psoriasis 6685 3.16437443345641E-11
lung carcinoma 2844 3.61723380669301E-9
ulcerative colitis 2087 2.09238459178446E-6
tuberculosis 1563 2.28926239917211E-6
ovarian cancer 8492 3.18650089232737E-6
oligodendroglioma 2849 1.07050436850683E-5
posterior fossa group A ependymoma 1511 1.67055239646039E-5
lung cancer 4473 2.77633894310736E-5
Atopic dermatitis 944 5.84832090966888E-5
inflammatory breast cancer 404 6.21790376245044E-5
invasive ductal carcinoma 2950 1.2020783361773E-4
primary Sjogren syndrome 789 1.79877342773444E-4
adult high grade glioma 2148 9.29805124677836E-4
urothelial carcinoma 318 0.00106219037160974
group 4 medulloblastoma 1875 0.00113418175383903
cutaneous lupus erythematosus 1056 0.00189942612936989
ductal carcinoma in situ 1745 0.00326548585666696
pilocytic astrocytoma 3086 0.00502586686764239
medulloblastoma, large-cell 6234 0.00625984280074898
breast carcinoma 1614 0.00729493178453718
glioblastoma 5572 0.00949295118624715
Down syndrome 548 0.0130164155388398
Multiple myeloma 1328 0.027833592649827
pancreatic cancer 2300 0.0301005690801461
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.03254513645612
esophageal adenocarcinoma 737 0.0390499691410918
hepatocellular carcinoma 550 0.0497693762153283

Expression

  Differential Expression (30)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.050
Multiple myeloma -1.023 0.028
urothelial carcinoma -3.800 0.001
esophageal adenocarcinoma 1.900 0.039
psoriasis -4.300 0.000
cutaneous lupus erythematosus 3.700 0.002
astrocytoma 2.300 0.000
glioblastoma 3.000 0.009
oligodendroglioma 1.600 0.000
periodontitis 1.800 0.000
medulloblastoma, large-cell -1.600 0.006
Atopic dermatitis 2.700 0.000
tuberculosis -3.700 0.000
intraductal papillary-mucinous carcinoma... -1.500 0.033
lung cancer -2.900 0.000
pancreatic cancer 1.100 0.030
breast carcinoma 1.500 0.007
adult high grade glioma 1.900 0.001
group 4 medulloblastoma -1.600 0.001
pilocytic astrocytoma 1.700 0.005
posterior fossa group A ependymoma 1.800 0.000
primary Sjogren syndrome 2.100 0.000
invasive ductal carcinoma 3.900 0.000
inflammatory breast cancer -2.300 0.000
lung carcinoma -2.100 0.000
non-small cell lung carcinoma 1.200 0.000
ductal carcinoma in situ 2.700 0.003
ulcerative colitis 3.700 0.000
ovarian cancer 3.800 0.000
Down syndrome 2.700 0.013

Synonym

Accession Q08116 B2RDM9 B4DZY0 Q07918 Q9H1W2 RGS1
Symbols 1R20
BL34
IER1
IR20
HEL-S-87

Gene

RGS1

PANTHER Protein Class (2)

PDB

2GTP   2BV1  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (3)

 GO Component (3)

 GO Process (8)

 Compartment GO Term (21)

See all...

 MGI Term (2)

 HCA RNA Cell Line (33)

See all...

Pathway (15)

See all...

 UniProt Keyword (9)

Gene RIF (27)

PMID Text
26222051 RGS1 as a potential marker of CRC tissue quality
25897806 RGS1 suppresses CXCL12-mediated migration and AKT activation in cultured human plasmacytoma cells and plasmablasts.
25782711 Rgs1 has a role in leukocyte trafficking and vascular inflammation
24162774 HIV-1 gp120 upregulates the expression of regulator of G-protein signaling 1 (RGS1) in human B cells
24130709 RGS1 and TNFRSF1A polymorphisms tended to be associated with reduced attack severity in Multiple sclerosis.
23898208 HIV-1 gp120 upregulates the expression of regulator of G-protein signaling 1 (RGS1) in human B cells
23464602 RGS1 is largely upregulated, whereas RGS2 is downregulated in the majority of solid tumors, whereas RGS5 transcripts are greatly increased in eight subtypes of lymphoma with no reports of downregulation in hematological malignancies
23324853 Markers in the RGS1 gene might be in linkage disequilibrium with a protective allele that reduces the risk of anxiety and depressive disorders.
21795595 Elevated RGS1 levels profoundly reduce T cell migration to lymphoid-homing chemokines
20647273 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence 

MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKS      1 - 70
KDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF     71 - 140
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK     141 - 209
//

Text Mined References (42)

PMID Year Title
26222051 2015 Identification and Validation of a Potential Marker of Tissue Quality Using Gene Expression Analysis of Human Colorectal Tissue.
25897806 2015 Regulator of G protein signaling 1 suppresses CXCL12-mediated migration and AKT activation in RPMI 8226 human plasmacytoma cells and plasmablasts.
25782711 2015 RGS1 regulates myeloid cell accumulation in atherosclerosis and aortic aneurysm rupture through altered chemokine signalling.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23324853 2013 Genetic association between RGS1 and internalizing disorders.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21795595 2011 Cutting Edge: Regulator of G protein signaling-1 selectively regulates gut T cell trafficking and colitic potential.
20647273 2010 Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...