Property Summary

NCBI Gene PubMed Count 283
Grant Count 424
R01 Count 285
Funding $49,585,536.56
PubMed Score 1275.39
PubTator Score 682.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q08050 O43258 O43259 O43260 Q4ZGG7 Q9BRL2
Symbols MPP2
HFH11
HNF-3
INS-1
MPP-2
PIG29
FKHL16
FOXM1B
HFH-11
TRIDENT
MPHOSPH2

Gene

PDB

3G73  

Gene RIF (273)

PMID Text
27455555 the FoxM1/Mcl-1 pathway may overcome cispaltin resistance of gastric cancer and provide a new therapeutic target for the treatment of gastric cancer
26912724 Deubiquitinated FoxM1 accumulation in the nucleus promotes recruitment of beta-catenin to Wnt target-gene promoter and activates the Wnt signaling pathway by protecting the beta-catenin/TCF4 complex from ICAT inhibition.
26884854 ACSL4, CGGBP1 and PGRMC2 were significantly downregulated with FOXM1 reduction in breast cancer cells, attenuating cell migration.
26790640 these results uncover a previous unknown network involving FBXL2 and FoxM1 in the regulation of gastric cancer growth.
26722467 FOXM1 was a direct target gene of miR-204, and miR-204 regulated invasion and epithelial-mesenchymal transition in esophageal cancer by acting directly on the 3'UTR of FOXM1 mRNA and suppressing its protein expression
26648534 overexpression of FOXM1 is associated with multiple myeloma.
26640950 Downregulation of FOXM1 by siRNA significantly inhibited the proliferation of melanoma cells, and blockade of the MAPK and PI3K/AKT pathways decreased the FOXM1 expression in melanoma cell lines.
26617733 miR-370 inhibited cell growth and metastasis in osteosarcoma cells by down-regulation of FOXM1.
26588055 Data indicate that microRNA miR-671-5p functions as a tumor suppressor in breast cancer by directly targeting forkhead box M1 (FOXM1).
26576650 FOXM1 is overexpressed in a large proportion of gastric carcinomas at the protein level and FOXM1 and PLK1 are concomitantly overexpressed at the mRNA level in this cancer type
More...

AA Sequence

MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTM      1 - 70
PNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLET     71 - 140
LGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENC    141 - 210
HLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPG    211 - 280
WKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELR    281 - 350
RNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA    351 - 420
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSP    421 - 490
APSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPEL    491 - 560
LFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPA    561 - 630
KVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVP    631 - 700
KPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ           701 - 763
//

Text Mined References (290)

PMID Year Title
27455555 2016 Knockdown of the FoxM1 enhances the sensitivity of gastric cancer cells to cisplatin by targeting Mcl-1.
26912724 2016 Wnt-induced deubiquitination FoxM1 ensures nucleus ?-catenin transactivation.
26884854 2015 Quantitative proteomic analysis identifies new effectors of FOXM1 involved in breast cancer cell migration.
26790640 2016 F-box protein FBXL2 inhibits gastric cancer proliferation by ubiquitin-mediated degradation of forkhead box M1.
26722467 2015 miR-204 inhibits invasion and epithelial-mesenchymal transition by targeting FOXM1 in esophageal cancer.
26648534 2016 FOXM1 is a therapeutic target for high-risk multiple myeloma.
26640950 2015 Investigation of FOXM1 as a Potential New Target for Melanoma.
26617733 2015 MicroRNA-370 directly targets FOXM1 to inhibit cell growth and metastasis in osteosarcoma cells.
26588055 2016 miR-671-5p inhibits epithelial-to-mesenchymal transition by downregulating FOXM1 expression in breast cancer.
26576650 2015 FOXM1 and polo-like kinase 1 are co-ordinately overexpressed in patients with gastric adenocarcinomas.
More...