Property Summary

NCBI Gene PubMed Count 335
PubMed Score 1384.80
PubTator Score 682.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma 2.226 1.7e-04
adult high grade glioma 2.200 7.0e-05
Atopic dermatitis 1.800 1.2e-05
atypical teratoid / rhabdoid tumor 2.900 1.5e-10
Breast cancer 2.300 3.0e-12
breast carcinoma 1.200 9.5e-31
colon cancer 1.100 4.2e-02
ductal carcinoma in situ 1.700 4.7e-03
Endometriosis 1.634 1.0e-02
ependymoma 1.400 9.6e-06
glioblastoma 3.000 1.9e-10
group 3 medulloblastoma 3.600 1.7e-09
intraductal papillary-mucinous carcinoma... 1.700 1.4e-04
intraductal papillary-mucinous neoplasm ... 1.600 7.4e-04
invasive ductal carcinoma 2.400 1.3e-04
lung adenocarcinoma 1.300 3.8e-12
lung cancer 2.100 2.2e-02
malignant mesothelioma 1.700 8.4e-08
medulloblastoma, large-cell 3.600 8.3e-07
non-small cell lung cancer 3.186 9.9e-29
osteosarcoma -2.345 1.4e-02
ovarian cancer 2.000 5.0e-06
pancreatic cancer 1.200 8.6e-04
primitive neuroectodermal tumor 3.200 1.6e-05
psoriasis -1.300 1.8e-03

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (323)

AA Sequence

MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTM      1 - 70
PNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLET     71 - 140
LGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENC    141 - 210
HLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPG    211 - 280
WKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELR    281 - 350
RNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA    351 - 420
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSP    421 - 490
APSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPEL    491 - 560
LFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPA    561 - 630
KVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVP    631 - 700
KPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ           701 - 763
//

Text Mined References (343)

PMID Year Title